kernel-16k-modules-partner-6.13.8-400.asahi.el9@>0     3!Iͩ\d:÷(Uފ<g_Uleif.linux@gmail.com Uފ<r@)ўFQ|?y:װFvs*Z3^lh`K#V%6H# 206580e766abafd792b8a8075757f621928335073656ca1b4a0235024f71991da3a819f6a35e93d32f93e2d71787b5fc64b669ad ]B|>}|!(>>?d$ 2 [  &>DL}^(^ "^ +^ =^ B6^ F^X ^m^^T   } (8 F9$F:%F>@G(^H^I^Xx Y \X^]^^.bo|dpepfplptp^uH^vw$^x^y$(.ptCkernel-16k-modules-partner6.13.8400.asahi.el9Extra kernel modules to match the kernelThis package provides kernel modules for the kernel package for Red Hat partners usage.gurocky-usb.lanښ((GPL-2.0-only WITH Linux-syscall-note) OR BSD-2-Clause) AND ((GPL-2.0-only WITH Linux-syscall-note) OR BSD-3-Clause) AND ((GPL-2.0-only WITH Linux-syscall-note) OR CDDL-1.0) AND ((GPL-2.0-only WITH Linux-syscall-note) OR Linux-OpenIB) AND ((GPL-2.0-only WITH Linux-syscall-note) OR MIT) AND ((GPL-2.0-or-later WITH Linux-syscall-note) OR BSD-3-Clause) AND ((GPL-2.0-or-later WITH Linux-syscall-note) OR MIT) AND 0BSD AND BSD-2-Clause AND (BSD-2-Clause OR Apache-2.0) AND BSD-3-Clause AND BSD-3-Clause-Clear AND CC0-1.0 AND GFDL-1.1-no-invariants-or-later AND GPL-1.0-or-later AND (GPL-1.0-or-later OR BSD-3-Clause) AND (GPL-1.0-or-later WITH Linux-syscall-note) AND GPL-2 AND GPL-2.0-only AND (GPL-2.0-only OR Apache-2.0) AND (GPL-2.0-only OR BSD-2-Clause) AND (GPL-2.0-only OR BSD-3-Clause) AND (GPL-2.0-only OR CDDL-1.0) AND (GPL-2.0-only OR GFDL-1.1-no-invariants-or-later) AND (GPL-2.0-only OR GFDL-1.2-no-invariants-only) AND (GPL-2.0-only WITH Linux-syscall-note) AND GPL-2.0-or-later AND (GPL-2.0-or-later OR BSD-2-Clause) AND (GPL-2.0-or-later OR BSD-3-Clause) AND (GPL-2.0-or-later OR CC-BY-4.0) AND (GPL-2.0-or-later WITH GCC-exception-2.0) AND (GPL-2.0-or-later WITH Linux-syscall-note) AND ISC AND LGPL-2.0-or-later AND (LGPL-2.0-or-later OR BSD-2-Clause) AND (LGPL-2.0-or-later WITH Linux-syscall-note) AND LGPL-2.1-only AND (LGPL-2.1-only OR BSD-2-Clause) AND (LGPL-2.1-only WITH Linux-syscall-note) AND LGPL-2.1-or-later AND (LGPL-2.1-or-later WITH Linux-syscall-note) AND (Linux-OpenIB OR GPL-2.0-only) AND (Linux-OpenIB OR GPL-2.0-only OR BSD-2-Clause) AND Linux-man-pages-copyleft AND MIT AND (MIT OR Apache-2.0) AND (MIT OR GPL-2.0-only) AND (MIT OR GPL-2.0-or-later) AND (MIT OR LGPL-2.1-only) AND (MPL-1.1 OR GPL-2.0-only) AND (X11 OR GPL-2.0-only) AND (X11 OR GPL-2.0-or-later) AND Zlib AND (copyleft-next-0.3.1 OR GPL-2.0-or-later)System Environment/Kernelhttps://www.kernel.org/linuxaarch64/sbin/depmod -a 6.13.8-400.asahi.el9.aarch64+16k/sbin/depmod -a 6.13.8-400.asahi.el9.aarch64+16krƐAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA큤g2g!g!g6~g6yg6xg6xg!g!g6og!g6xg6xg6xg6xg6fg6tg!g6xg!g6fg6gg6fg6fg6fg6fg6gg6vg6pg!g6pg!g6fg6dg6dg6dg6dg6dg6dg6dg6cg6cg6dg6dg6dg6eg6fg6eg!g6eg6eg6eg6eg!g6eg6eg6eg6eg6eg6eg6eg6eg6eg!g!g6fg6fg6fg6fg6eg6fg6gg6fg6gg!g6fg6eg6eg6eg6eg6eg6eg6eg6tg6tg6xg6xg6eg6eg6yg!g6xg6yg6yg6xg6xg6yg6xg6xg6yg6eg6og6fg6fg!g6eg!g6eg6fg!g6eg6eg6fg6tg6eg6tg!g6mg6gg!g6yg6ig6gg6hg!g6hg6gg6gg6gg6gg6gg6gg6gg6gg6ig6gg!g6fg6gg6ig6jg!g6fg6fg6mg6gg6fg6kg6hg6mg6gg6hg6hg6fg6gg6ig!g6gg6gg6fg6ig6gg6gg!g6gg6hg6kg6ig6hg6gg6kg6gg6gg6hg6jg6kg6gg6ug6ug6ug6ug6ug6vg6wg6wg6wg6cg!g6dg6dg6eg6eg6eg6eg6fg6fg6fg6vg6vg6vg6vg6vg6vg6vg6vg!g6vg6vg6vg6vg6vg6vg6ug6ug6vg6vg6vg6vg6vg6vg6vg6vg6vg6vg6vg6vg6vg6vg6vg6vg6vg6vg6ug6vg!g6vg!g6wg!g6vg6wg6wg6wg6wg6vg6wg6vg6wg6wg!g6vg6vg!g6wg6wg6wg6wg6wg6wg6tg6tg6tg6tg6tg6ug6tg6tg6ug6ug!g6ug!g6hg6hg6og!g!g6og6xg6eg6eg6dg6eg6fg6ug6ug6ug6ug!g!g6qg6qg!g6qg6qg6qg6qg!g6qg6qg6rg6rg6rg6rg6rg6rg6sg6sg6sg6qg6pg6qg6pg6qg6pg6qg!g6tg!g6sg6sg6sg6sg6tg6sg6sg6sg6tg6tg6tg6sg6sg6sg6sg6sg6sg6sg6sg6tg6sg6sg6rg!g6rg6rg!g6rg6sg6rg!g6rg6rg6sg!g6rg6sg6rg6rg6sg!g6rg6rg!g6rg6sg6rg6rg6rg!g6rg6rg!g6rg6rg6rg6rg!g6sg6sg6rg6rg6qg6rg6rg6rg6rg6rg6sg6sg6rg6rg!g6tg6tg6tg6sg6tg6tg6tg6tg6tg6tg6tg6sg6tg6tg6tg6tg6tg6sg6tg6tg6tg6rg6ug6ug!g6xg6xg6dg6wg6vg6vg6vg6vg6vg6vg6vg6vg6vg6vg6vg6vg!g6xg6xg6ug6ug6ug6ug6ug6ug6ug6ug6ug6ug6ug6dg6og6hg6hg6hg6hg6hg6hg6hg6hg6hg6hg6hg6hg6hg6hg6hg6hg6og6og6og6og6og6og6og6kg6jg6ig6ig6jg6ig!g6jg6ig6ig6ig!g6jg6jg!g6kg6ig6jg!g6ig6ig6ig6ig6mg6lg6lg6mg6ig!g6lg6lg!g6ig6kg6kg6jg!g6kg6kg6kg6kg!g6lg6hg6kg6jg6kg6kg6kg!g6jg6jg!g6hg6ig6hg6hg6ig6jg6kg6lg6jg6kg6mg6ng6lg6lg6lg6mg6ng6jg6lg6jg6kg6kg6jg6jg6kg!g6jg6jg6kg!g6ng!g6lg6ng6mg6ng6lg6jg6kg!g6hg!g6ig6jg6jg!g6ig6lg6kg!g6lg6jg6jg6jg6ig6jg!g6kg6kg6kg6kg6jg!g6kg6kg6kg6kg!g6jg6kg6ig6ig6jg6lg!g6hg6hg6hg6jg6og6ig6og6og6og6hg6hg!g6og6og6og6ng6og6og6kg6kg6og6hg6og6hg6kg6kg!g6ng6ng6mg6mg6ng6mg6lg6mg6ng6mg6lg!g6mg6mg!g6og6ng6ng6ng6ng6ng!g6pg6pg6og6og!g!g6og6og6og!g6lg6lg6lg6lg6lg6lg6lg6lg6kg6lg!g6ng!g6og!g!g6og6ng6ng6og6og6ng6ng6ng6ng6ng6ng6ng6og6ng6ng6ng6ng6og6ng6lg!g6mg!g6mg6mg6mg6mg6pg!g6ng6og6og6og6xg6xg6xg6xg6xg6xg6xg6pg!g6hg6ig6hg6eg6eg!g6vg6vg6vg6vg6vg6vg6dg6dg6dg6fg6fg6fg6fg6fg6fg6fg6fg6fg6fg6fg6fg6gg6fg6vg6vg6wg!g6og6og6og6og6og6og!g6fg6hg6hg!g6fg6fg6fg6eg!g6pg6xg6ug6eg6eg6eg6vg6eg6eg6eg6eg6ug6fg6rg6pg6pg6pg6qg6pg6pg6pg6pg6qg6pg6rg6qg6pg6pg6qg6rg6pg6qg6qg6qg6pg6rg6qg6qg6pg6qg6pg!g6tg6tg6tg6tg6tg6tg6tg6tg6tg6eg6tg6vg6pg!g!g6xg!g6xg6xg!g6xg6xg6xg6xg6yg6yg6yg6xg6hg6fg6gg6gg6fg6fg6fg6fg6fg6eg6eg6eg6eg6eg6fg6fg6fg6fg!g6tg6tg6eg!g6wg6wg6xg6wg6xg6wg6xg6wg6xg6xg6xg6xg6xg6wg6xg6xg6xg6xg6xg6wg6xg6xg6wg6wg6wg6wg6wg6wg6wg!g6xg6xg6xg6xg6xg6xg6xg6xg6eg6eg6eg6fg6eg6eg6eg6eg6eg6eg6eg6eg!g6pg!g6xg6wg6wg6og6og6og6og6ug6|g6yg!g6|g6yg6yg6zg6yg6yg6yg!g6~g6yg6yg6yg6}g6yg6}g6yg6yg6yg6yg6zg6|g6yg6|g6|g6yg6}g6zg6zg6yg6yg6yg6zg6yg!g6g6yg6yg6yg6zg6zg6{g6zg6{g!g6{g!g!g!g6{g6~g6~g!g6~g6~g!g6~g6~g!g!g6yg6yg6yg6{g6zg6yg6zg6|g6zg6zg6zg6zg6yg6yg6yg6yg6|g6|g6yg6{g!g6{g6|g6|g6yg6zg6zg6zg6zg6zg6{g6{g6zg6yg6{g!g6{g6yg!g6{g6{g6{g6{g6{g6{g6{g6zg6yg6yg6yg6zg6|g!g6{g6{g6{g6zg6yg6zg6|g6{g6{g6{g!g6{g6|g6~g6|g6|g6{g6{g6{g6{g6{g6{g6{g6{g6{g6{g6~g6~g6~g6~g6~g6~g6~g6}g6~g6~g6~g6}g6~g6~g6~g6~g6~g6~g6}g6}g6}g6~g6}g6}g6|g6}g6}g6}g6|g6}g6{g6{g6}g6|g6|g6|g6|g6|g6|g6|g6}g6~g6|g6|g6|g6|g6~g6~g6~g6~g6~g6~g6~g6|g!g5g532d93fc03e020da7ad7ed65628d8b467958ae79634ede48f8baac2381ed01a22cf7ed2fe23195bccbb83361d603c65f0b1f7a9f4809b5fc55fab683cbbf3b98e9ebbbdda12ddcd66d21df02965313ab7f7ca2fbc0b0fb574335b3d52eade48d6rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootkernel-6.13.8-400.asahi.el9.src.rpmconfig(kernel-16k-modules-partner)installonlypkg(kernel-module)kernel-16k-modules-partnerkernel-16k-modules-partnerkernel-16k-modules-partner(aarch-64)kernel-16k-modules-partner-aarch64kernel-16k-modules-partner-aarch64kernel-16k-modules-partner-uname-rkmod(kafs.ko)kmod(rxrpc.ko)modalias(fs-afs)modalias(net-pf-33)    /bin/sh/bin/shkernel-16k-modules-core-uname-rkernel-16k-modules-uname-rkernel-uname-rrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)6.13.8-400.asahi.el9.aarch64++16k6.13.8-400.asahi.el9.aarch64++16k6.13.8-400.asahi.el9.aarch64++16k3.0.4-14.6.0-14.0-15.2-14.16.1.3g@gަ@gggSg@g$gG@g g:g@ggF@gg@gQg@gg]@g g@g~hg}@g{gzt@gy"gw@gvgsgr@gq9go@gngkgj@giPgg@gfge\@gd gb@gagg`@g^g]s@g\!gZ@gY~gX-@gVgU@gT8gR@gQgPD@gNgM@gJ@gIgH[@gG gE@gC@gAgAg@r@g? g? g=@g<}Neal Gompa [6.13.8-400.asahi]Justin M. Forbes [6.13.8-0]Augusto Caringi [6.13.7-0]Augusto Caringi [6.13.6-0]Justin M. Forbes [6.13.5-0]Justin M. Forbes [6.13.4-0]Justin M. Forbes [6.13.3-0]Justin M. Forbes [6.13.2-0]Justin M. Forbes [6.13.1-0]Fedora Kernel Team [6.13.0-61]Fedora Kernel Team [6.13.0-0.rc7.fda5e3f28400.60]Fedora Kernel Team [6.13.0-0.rc7.595523945be0.59]Fedora Kernel Team [6.13.0-0.rc7.9bffa1ad25b8.58]Fedora Kernel Team [6.13.0-0.rc7.619f0b6fad52.57]Fedora Kernel Team [6.13.0-0.rc7.619f0b6fad52.56]Fedora Kernel Team [6.13.0-0.rc7.c45323b7560e.55]Fedora Kernel Team [6.13.0-0.rc7.54]Fedora Kernel Team [6.13.0-0.rc6.b62cef9a5c67.53]Fedora Kernel Team [6.13.0-0.rc6.77a903cd8e5a.52]Fedora Kernel Team [6.13.0-0.rc6.2144da25584e.51]Fedora Kernel Team [6.13.0-0.rc6.eea6e4b4dfb8.50]Fedora Kernel Team [6.13.0-0.rc6.09a0fa92e5b4.49]Fedora Kernel Team [6.13.0-0.rc6.fbfd64d25c7a.48]Fedora Kernel Team [6.13.0-0.rc6.47]Fedora Kernel Team [6.13.0-0.rc5.ab75170520d4.46]Fedora Kernel Team [6.13.0-0.rc5.63676eefb7a0.45]Fedora Kernel Team [6.13.0-0.rc5.0bc21e701a6f.44]Fedora Kernel Team [6.13.0-0.rc5.56e6a3499e14.43]Fedora Kernel Team [6.13.0-0.rc5.ccb98ccef0e5.42]Fedora Kernel Team [6.13.0-0.rc5.41]Fedora Kernel Team [6.13.0-0.rc4.059dd502b263.40]Fedora Kernel Team [6.13.0-0.rc4.fd0584d220fe.39]Fedora Kernel Team [6.13.0-0.rc4.d6ef8b40d075.38]Fedora Kernel Team [6.13.0-0.rc4.9b2ffa6148b1.37]Fedora Kernel Team [6.13.0-0.rc4.f07044dd0df0.36]Fedora Kernel Team [6.13.0-0.rc4.35]Fedora Kernel Team [6.13.0-0.rc3.48f506ad0b68.34]Fedora Kernel Team [6.13.0-0.rc3.499551201b5f.33]Fedora Kernel Team [6.13.0-0.rc3.8faabc041a00.32]Fedora Kernel Team [6.13.0-0.rc3.eabcdba3ad40.31]Fedora Kernel Team [6.13.0-0.rc3.aef25be35d23.30]Fedora Kernel Team [6.13.0-0.rc3.f44d154d6e3d.29]Fedora Kernel Team [6.13.0-0.rc3.28]Fedora Kernel Team [6.13.0-0.rc2.2d8308bf5b67.27]Fedora Kernel Team [6.13.0-0.rc2.a446e965a188.26]Fedora Kernel Team [6.13.0-0.rc2.f932fb9b4074.25]Fedora Kernel Team [6.13.0-0.rc2.231825b2e1ff.24]Fedora Kernel Team [6.13.0-0.rc2.f92f4749861b.23]Fedora Kernel Team [6.13.0-0.rc2.7cb1b4663150.22]Fedora Kernel Team [6.13.0-0.rc2.21]Fedora Kernel Team [6.13.0-0.rc1.7503345ac5f5.20]Fedora Kernel Team [6.13.0-0.rc1.b5f217084ab3.19]Fedora Kernel Team [6.13.0-0.rc1.b8f52214c61a.18]Fedora Kernel Team [6.13.0-0.rc1.feffde684ac2.17]Fedora Kernel Team [6.13.0-0.rc1.feffde684ac2.16]Fedora Kernel Team [6.13.0-0.rc1.cdd30ebb1b9f.15]Fedora Kernel Team [6.13.0-0.rc1.e70140ba0d2b.14]Fedora Kernel Team [6.13.0-0.rc0.2ba9f676d0a2.13]Fedora Kernel Team [6.13.0-0.rc0.7af08b57bcb9.12]Fedora Kernel Team [6.13.0-0.rc0.b86545e02e8c.11]Fedora Kernel Team [6.13.0-0.rc0.aaf20f870da0.10]Fedora Kernel Team [6.13.0-0.rc0.7eef7e306d3c.9]Fedora Kernel Team [6.13.0-0.rc0.9f16d5e6f220.8]Fedora Kernel Team [6.13.0-0.rc0.228a1157fb9f.7]Fedora Kernel Team [6.13.0-0.rc0.28eb75e178d3.6]Fedora Kernel Team [6.13.0-0.rc0.fcc79e1714e8.5]Fedora Kernel Team [6.13.0-0.rc0.fcc79e1714e8.4]Fedora Kernel Team [6.13.0-0.rc0.bf9aa14fc523.3]Fedora Kernel Team [6.13.0-0.rc0.158f238aa69d.2]Fedora Kernel Team [6.13.0-0.rc0.158f238aa69d.1]- apply -Wno-error=unterminated-string-initialization temporarily (Thorsten Leemhuis) - include/linux: Adjust headers for C23 (Jakub Jelinek) - redhat: Conditionally disable libbpf_dynamic on (Janne Grunau) - media: apple: isp: Support system sleep (Eileen Yoon) - media: apple: isp: Use a mutex instead of a spinlock for channels (Hector Martin) - media: apple: isp: implement ENUM_FRAMEINTERVALS trivially (Hector Martin) - media: apple: isp: Enable IMX364 sensor (Hector Martin) - media: apple: isp: Show camera presets even for unsupported sensors (Hector Martin) - media: apple: isp: Parse firmware version from device tree (Janne Grunau) - media: apple: isp: Use a more user-friendly device name (Hector Martin) - media: apple: isp: Option to use CMD_STOP (ifdeffed out) (Asahi Lina) - media: apple: isp: Only reset coproc when necessary, fix minor race (Asahi Lina) - media: apple: isp: VMap only what is necessary, remove redundant logging state bit (Asahi Lina) - media: apple: isp: Add a missing read barrier (possibly?) (Asahi Lina) - media: apple: isp: Clear IRQs when resetting coproc (Asahi Lina) - media: apple: isp: Rework meta surface handling & buffer return (Asahi Lina) - media: apple: isp: Use cached IOMMU mappings (Asahi Lina) - media: apple: isp: Zero out pages allocated to ISP (Asahi Lina) - media: apple: isp: Make sub-pmdomain handling explicit (Asahi Lina) - media: apple: isp: Minor changes to cam flow (Asahi Lina) - media: apple: isp: Add flicker_sensor_set cmd (Asahi Lina) - media: apple: isp: t8112 fixes... (Asahi Lina) - media: apple: isp: Limit maximal number of buffers (Janne Grunau) - media: apple: isp: t8112 HW config (Janne Grunau) - media: apple: isp: Use a second region for MBOX_IRQ_{DOORBELL,ACK} (Janne Grunau) - media: apple: isp: Make channel sends not interruptible (Asahi Lina) - media: apple: isp: Maybe fix some DMA ordering issues (Asahi Lina) - media: apple: isp: Add STOP and POWER_DOWN commands (Asahi Lina) - media: apple: isp: Implement posted commands (Asahi Lina) - media: apple: isp: Propagate EINTR from firmware loads (Asahi Lina) - media: apple: isp: Remove ioread/iowrite and stop doing raw address translation (Asahi Lina) - media: apple: isp: Switch to threaded IRQs (Asahi Lina) - media: apple: isp: Always enable singleplane API, make multiple a module param (Asahi Lina) - media: apple: isp: Working t602x and multiple formats and more fixes (Asahi Lina) - media: apple: isp: t602x hw config (Asahi Lina) - media: apple: isp: Support >32bit VAs for t602x (Asahi Lina) - media: apple: isp: fix copyright (Eileen Yoon) - media: apple: isp: alloc static surfaces only once (Eileen Yoon) - media: apple: isp: misc isp-fw.c improvements (Eileen Yoon) - media: apple: isp: rm old isp_resv struct (Eileen Yoon) - media: apple: isp: rm unused bootargs members (Eileen Yoon) - media: apple: isp: s/asc/coproc/ (Eileen Yoon) - media: apple: isp: wmb() before GPIO write (Eileen Yoon) - media: apple: isp: Don't use define for bootargs size (Eileen Yoon) - media: apple: isp: Better document info struct fields (Eileen Yoon) - media: apple: isp: Set platform_id in bootargs (Eileen Yoon) - media: apple: WIP: t6000 hax (Hector Martin) - media: apple: isp: Do not defer on failure to initialize DART (Hector Martin) - media: apple: isp: Drop the DART mirroring stuff (Hector Martin) - media: apple: isp: Split gpio/mbox MMIO range (Eileen Yoon) - media: apple: isp: Enable t6000 (Hector Martin) - media: apple: isp: Fixup shared region arg (Hector Martin) - media: apple: isp: Use preallocated heap (Hector Martin) - media: apple: isp: IMX558 initial support (Eileen Yoon) - media: apple: Add Apple ISP driver (Eileen Yoon) - gpu: drm: adp: Allow max brightness to be set via device tree (Nick Chan) - gpu: drm: adp: Use 16-bit writes for brightness (Nick Chan) - MAINTAINERS: Add entries for Apple Z2 touchscreen driver (Sasha Finkelstein) - input: apple_z2: Add a driver for Apple Z2 touchscreens (Sasha Finkelstein) - dt-bindings: input: touchscreen: Add Z2 controller bindings. (Sasha Finkelstein) - gpu: drm: adp: base the max framebuffer width and height on screen size (Janne Grunau) - gpu: drm: adp: Refuse X* as client in open() (Janne Grunau) - MAINTAINERS: Add entries for touchbar display driver (Sasha Finkelstein) - gpu: drm: adp: Add a backlight driver for the Summit LCD (Sasha Finkelstein) - gpu: drm: adp: Add Apple Display Pipe driver (Sasha Finkelstein) - arm64: cpufeature: Unify SCOPE_LOCAL_CPU early & late behavior (Asahi Lina) - KVM: arm64: Expose TSO capability to guests and context switch (Asahi Lina) - arm64: Implement Apple IMPDEF TSO memory model control (Hector Martin) - arm64: Introduce scaffolding to add ACTLR_EL1 to thread state (Hector Martin) - arm64: Implement PR_{GET,SET}_MEM_MODEL for always-TSO CPUs (Hector Martin) - prctl: Introduce PR_{SET,GET}_MEM_MODEL (Hector Martin) - drm/asahi: crashdump: Clippy fixes (Asahi Lina) - drm/asahi: Hook up crashdump to devcoredump (Asahi Lina) - rust: devcoredump: Add devcoredump abstraction (Asahi Lina) - rust: uapi: Add ELF headers (Asahi Lina) - drm/asahi: use only a single run queue for drm-sched (Janne Grunau) - drm/asahi: Depend on DRM=y (Janne Grunau) - drm/asahi: workqueue: Access AsahiData via pdev.drvdata (Janne Grunau) - drm/asahi: queue: Access AsahiData via pdev.drvdata (Janne Grunau) - drm/asahi: mmu: Access AsahiData via pdev.drvdata (Janne Grunau) - drm/asahi: gpu: Access AsahiData via pdev.drvdata (Janne Grunau) - drm/asahi: Add AsahiData to the platform device drvdata (Janne Grunau) - drm/asahi: file: adapt to new DRM file/ioctl rust abstractions (Janne Grunau) - drm/asahi: driver: Port to dma_set_mask_and_coherent() from ml (Janne Grunau) - drm/asahi: regs: Update to upstream-ish io::IoMem (Janne Grunau) - drm/asahi: Adapt robust_isolation module parameter (Janne Grunau) - drm/asahi: Adapt initial_tvb_size module parameter (Janne Grunau) - drm/asahi: Adapt fault_control module parameter (Janne Grunau) - drm/asahi: Adapt debug_flags module parameter (Janne Grunau) - drm/asahi: Port to kernel::uaccess (Janne Grunau) - drm/asahi: pgtable: Fix missing nonglobal bit (Asahi Lina) - drm/asahi: regs: Clippy fixes (Asahi Lina) - drm/asahi: render: Clippy fixes (Asahi Lina) - drm/asahi: Get rid of util::div_ceil() (Asahi Lina) - drm/asahi: queue::compute: Clippy fixes (Asahi Lina) - drm/asahi: pgtable: Clippy fixes (Asahi Lina) - drm/asahi: object: Clippy fixes (Asahi Lina) - drm/asahi: microseq: Clippy fixes (Asahi Lina) - drm/asahi: mmu: Clippy fixes (Asahi Lina) - drm/asahi: mem: Clippy fixes (Asahi Lina) - drm/asahi: fw: Clippy fixes (Asahi Lina) - drm/asahi: float: Clippy fixes (Asahi Lina) - drm/asahi: File: Clippy fixes (Asahi Lina) - drm/asahi: event: Clippy fixes (Asahi Lina) - drm/asahi: channel: Clippy fixes (Asahi Lina) - drm/asahi: buffer: Clippy fixes (Asahi Lina) - drm/asahi: alloc: Clippy fixes (Asahi Lina) - drm/asahi: mmu: Use abstractions, drop bindings import (Asahi Lina) - drm/asahi: pgtable: Mark GPU entries as uncached (Asahi Lina) - drm/asahi: mmu: Preallocate page tables before sm_map() (Asahi Lina) - drm/asahi: gpu: Hook up crashdump generation (Asahi Lina) - drm/asahi: mmu: Wire up kernel AS dumper (Asahi Lina) - drm/asahi: crashdump: Add crash dumper module (Asahi Lina) - drm/asahi: pgtable: Add helpers for decoding PTE perms (Asahi Lina) - drm/asahi: pgtable: Add dumper (Asahi Lina) - drm/asahi: Depend on PAGE_SIZE_16KB (Asahi Lina) - drm/asahi: Implement ASAHI_BIND_SINGLE_PAGE (Asahi Lina) - drm/asahi: RiiR page tables (Asahi Lina) - drm/asahi: mmu: Add some barriers (Asahi Lina) - drm/asahi: debug: Add PgTable debug category (Asahi Lina) - drm: asahi: mmu: UAT change for rust page table rewrite (Asahi Lina) - drm/asahi: mmu: Change step_remap() to new api (Asahi Lina) - drm/asahi: mmu: Fix deadlock on remap ops (Asahi Lina) - drm/asahi: workqueue: Defer freeing the last completed work item (Asahi Lina) - drm/asahi: Update crashed() RTKit API (Asahi Lina) - drm/asahi: mmu: Fix 2x step_remap case (Asahi Lina) - drm/asahi: file: Reject gem_bind past the end of the object (Asahi Lina) - drm/asahi: mmu: Change step_remap() to new api (Asahi Lina) - drm/asahi: Map all reserved-regions as cached (Asahi Lina) - drm/asahi: Add the USER_TIMESTAMPS feature (Asahi Lina) - drm/asahi: Set a bit for internal non-render barriers on G14X (Asahi Lina) - drm/asahi: file: Add user_timestamp_frequency_hz to params (Asahi Lina) - drm/asahi: queue/render,compute: Plumb through timestamps extension (Asahi Lina) - drm/asahi: queue/render,compute: Handle cmdbuf size mismatches (Asahi Lina) - drm/asahi: fw, queue: Plumb through UserTimestamps -> TimestampPointers (Asahi Lina) - drm/asahi: queue: Plumb through objects XArray and add timestamp getter (Asahi Lina) - drm/asahi: fw, queue: Add UserTimestamp object to job structs (Asahi Lina) - drm/asahi: file: Implement ASAHI_GEM_BIND_OBJECT (Asahi Lina) - drm/asahi: gpu: Implement mapping timestamp buffers (Asahi Lina) - drm/asahi: util: Commend out unused len() method (Asahi Lina) - drm/asahi: gpu: Remove unused wait_for_poweroff() (Asahi Lina) - drm/asahi: workqueue: Restrict command objects to only job commands (Asahi Lina) - drm/asahi: alloc: Remove unused methods (Asahi Lina) - drm/asahi: Document timestamp ops better, refactor fields (Asahi Lina) - drm/asahi: gpu: Add a max object count garbage limit (Asahi Lina) - drm/asahi: alloc: Be more verbose about failures (Asahi Lina) - drm/asahi: gpu: Collect garbage for private/gpuro together (Asahi Lina) - drm/asahi: driver: Port to new device/driver registration (Janne Grunau) - drm/asahi: regs: Get device ref from platform dev (Janne Grunau) - drm/asahi: mmu: Move closer to rust of integration (Janne Grunau) - drm/asahi: gpu: Get resources directly through DRM pricate data (Janne Grunau) - drm/asahi: gpu: Force Box move with manual Box::into_inner() (Janne Grunau) - drm/asahi: Modify debug dev printk macros to avoid adding ".as_ref()" (Janne Grunau) - drm/asahi: Implement ASAHI_GET_TIME (Asahi Lina) - drm/asahi: Implement missing ASAHI_BIND_OP_UNBIND (Asahi Lina) - drm/asahi: Align kernel range to buffer::PAGE_SIZE (Asahi Lina) - drm/asahi: HACK: Disable compute preemption for now (Asahi Lina) - drm/asahi: Add robust_isolation kernel parameter (Asahi Lina) - drm/asahi: Clean up jobs in a workqueue (Asahi Lina) - drm/asahi: workqueue: Fix "Cannot submit, but queue is empty?" bug (Asahi Lina) - drm/asahi: workqueue,queue: More debug (Asahi Lina) - drm/asahi: event: Initialize stamps to different values (Asahi Lina) - drm/asahi: Handle channel errors (Asahi Lina) - drm/asahi: gpu: Show unknown field in timeouts (Asahi Lina) - drm/asahi: Fix event tracking when JobSubmission is dropped (Asahi Lina) - drm/asahi: Workqueue: Add more debug (Asahi Lina) - drm/asahi: Fix u32 mult overflow on large tilebufs/TPCs (Asahi Lina) - drm/asahi: Enable soft faults by default (Asahi Lina) - drm/asahi: Signal soft fault support to userspace (Asahi Lina) - drm/asahi: file: Update to newer VM_BIND API (Asahi Lina) - drm/asahi: workqueue: Tweak some debug logs (Asahi Lina) - drm/asahi: queue: Split into Queue and QueueInner (Asahi Lina) - drm/asahi: Implement GEM objects sharing a single DMA resv (Asahi Lina) - drm/asahi: mmu: Fix lockdep issues with GpuVm (Asahi Lina) - drm/asahi: Convert more ranges to Range<> (Asahi Lina) - drm/asahi: Move the unknown dummy page to the top of the address space (Asahi Lina) - drm/asahi: mmu: Convert to using Range (Asahi Lina) - drm/asahi: util: Add RangeExt helpers for Range (Asahi Lina) - drm/asahi: Refactor address types (Asahi Lina) - drm/asahi: Convert to GPUVM and implement more VM_BIND ops (Asahi Lina) - drm/asahi: Don't lock up when unmapping PTEs fails (Asahi Lina) - drm/asahi: microseq: Fix warnings (Asahi Lina) - drm/asahi: alloc: Do not allocate memory to free memory (Asahi Lina) - drm/asahi: Check command structure sizes (Asahi Lina) - drm/asahi: Identify and implement helper config register (Asahi Lina) - drm/asahi: compute: Allow no preemption flag (Asahi Lina) - drm/asahi: queue: Alocate the NotifierList as shared (Asahi Lina) - drm/asahi: workqueue: Work around ICE in Rust 1.74 (Asahi Lina) - drm/asahi: initdata: New init chain API for rebase (Hector Martin) - drm/asahi: render, buffer: Fix layered rendering on G13X (again) (Asahi Lina) - drm/asahi: render: Fix layered rendering on G14X (Asahi Lina) - drm/asahi: Fix Clippy complaints (Asahi Lina) - drm/asahi: Identify and allocate clustered layering metadata buf (Asahi Lina) - drm/asahi: Identify & add render VS spills flag (Asahi Lina) - drm/asahi: buffer: Complain more loudly about sync requests (Asahi Lina) - drm/asahi: render: Remove sync TVB growth support (Asahi Lina) - drm/asahi: file: Remove sync limit (Asahi Lina) - drm/asahi: Add verbose UAPI error reporting (Asahi Lina) - drm/asahi: queue: Quieten some debugs (Asahi Lina) - drm/asahi: render: Identify and set Z/S strides for layered rendering (Asahi Lina) - drm/asahi: fw,queue: Implement helper programs (Asahi Lina) - drm/asahi: render: Implement bindless samplers (Asahi Lina) - drm/asahi: compute: Implement bindless samplers (Asahi Lina) - drm/asahi: buffer,render: Identify and provide layer meta buf (Asahi Lina) - drm/asahi: workqueue: Tag GPU buf (Asahi Lina) - drm/asahi: render: Tag AuxFB (Asahi Lina) - drm/asahi: queue/compute: Tag preempt buf (Asahi Lina) - drm/asahi: initdata: Tag more arrays (Asahi Lina) - drm/asahi: buffer: Add tags to all the buffers (Asahi Lina) - drm/asahi: alloc: Use tag as the guard marker (Asahi Lina) - drm/asahi: alloc: Support tagging array allocs (Asahi Lina) - drm/asahi: Expose firmware version to userspace (Asahi Lina) - drm/asahi: hw/t602x: Increase meta/preempt sizes for G14D (Asahi Lina) - drm/asahi: gpu,hw: Fix array IOMappings (Asahi Lina) - drm/asahi: initdata: Fudge t3 calculation a bit (Asahi Lina) - drm/asahi: initdata,hw: Identify & set idle_off_standby_timer (Asahi Lina) - drm/asahi: initdata: Fixes for G14D (Asahi Lina) - drm/asahi: Increase recursion limit (Asahi Lina) - drm/asahi: Enable probing for t6022 (Asahi Lina) - drm/asahi: regs: Fix cluster count for G14D (Asahi Lina) - drm/asahi: hw.t602x: Fixes for t6022 (Asahi Lina) - drm/asahi: fw.channels: Add static assertions for message sizes (Asahi Lina) - drm/asahi: slotalloc: Allow initializing empty slots (Asahi Lina) - drm/asahi: initdata: Initialize GpuStatsFrag properly (Asahi Lina) - drm/asahi: render: Correct some values for G14 (Asahi Lina) - drm/asahi: hw/t8112: Make last IOMapping read-only (Asahi Lina) - drm/asahi: hw/t600x: Expand some mappings (Asahi Lina) - drm/asahi: fw/microseq: Document bits of has_attachments (Asahi Lina) - drm/asahi: initdata: Document more stuff (Asahi Lina) - drm/asahi: initdata: Fix 13.5 field position for G13X (Asahi Lina) - drm/asahi: fw/channels: Document more message types a bit (Asahi Lina) - drm/asahi: fw/channels: Identify subpipe(?) and halt_count fields in tvb ack (Asahi Lina) - drm/asahi: initdata: Fix ver_info for G13 V13.5 (Asahi Lina) - drm/asahi: hw: Drop max_dies (Asahi Lina) - drm/asahi: hw,initdata: Initdata fixes for G14S (Asahi Lina) - drm/asahi: render: Implement unknown value UAPI extension (Asahi Lina) - DO NOT MERGE: drm/asahi: Add an experimental UAPI extension (Asahi Lina) - drm/asahi: Add the Asahi driver for Apple AGX GPUs (Asahi Lina) - rust: bindings: Bind the Asahi DRM UAPI (Asahi Lina) - drm/asahi: Add the Asahi driver UAPI (Asahi Lina) - rust: macros: Add versions macro (Asahi Lina) - drm/gpuvm: Plumb through flags into drm_gpuva_init (Asahi Lina) - drm/gpuva: Add DRM_GPUVA_SINGLE_PAGE flag and logic (Asahi Lina) - drm/gpuvm: Plumb through flags into drm_gpuva_op_map (Asahi Lina) - drm/gpuvm: Add a flags argument to drm_gpuvm_sm_map[_*] (Asahi Lina) - rust: drm/gpuvm: Add GpuVaFlags support (Asahi Lina) - rust: drm/gpuvm: Add interruptible flag to exec_lock() (Asahi Lina) - rust: drm/gpuvm: bo_unmap() should take &GpuVmBo, not ARef. (Asahi Lina) - rust: drm/gpuvm: Pass vm_bo explicitly to step_remap() (Asahi Lina) - rust: drm/gpuvm: Take &GpuVmBo for map_and_link_va() (Asahi Lina) - rust: drm: Add GPUVM Manager abstraction (Asahi Lina) - drm/gpuvm: Add drm_gpuvm_bo_unmap() (Asahi Lina) - rust: drm: sched: Use &mut for ArmedJob.fences() (Janne Grunau) - drm/scheduler: Clean up jobs when the scheduler is torn down. (Asahi Lina) - rust: drm: sched: Add GPU scheduler abstraction (Asahi Lina) - drm/scheduler: Fix UAF in drm_sched_fence_get_timeline_name (Asahi Lina) - rust: drm: syncobj: Add DRM Sync Object abstraction (Asahi Lina) - rust: drm: mm: Add DRM MM Range Allocator abstraction (Asahi Lina) - rust: drm: gem: shmem: Add share_dma_resv() function (Asahi Lina) - rust: drm: gem: Add set_exportable() method (Asahi Lina) - drm/gem: Add a flag to control whether objects can be exported (Asahi Lina) - rust: drm: gem: shmem: Add DRM shmem helper abstraction (Asahi Lina) - rust: helpers: Add bindings/wrappers for dma_resv_lock (Asahi Lina) - drm/gem-shmem: Export VM ops functions (Asahi Lina) - drm/shmem-helper: Add lockdep asserts to vmap/vunmap (Asahi Lina) - rust: drm: Temporarily re-add drm driver date field (Janne Grunau) - rust: drm: gem: Add GEM object abstraction (Asahi Lina) - rust: drm: file: Add File abstraction (Asahi Lina) - rust: drm: add DRM driver registration (Danilo Krummrich) - rust: drm: add device abstraction (Danilo Krummrich) - rust: drm: add driver abstractions (Danilo Krummrich) - rust: drm: ioctl: Add DRM ioctl abstraction (Asahi Lina) - rust: dma_fence: Add DMA Fence abstraction (Asahi Lina) - drm/apple: fix audioless build (Alyssa Rosenzweig) - drm: apple: dptx: Issue HPD event early on gpio/type-c disconnect (Janne Grunau) - fixup! WIP: drm/apple: Add DCP display driver (Janne Grunau) - fixup! WIP: drm/apple: Add DCP display driver (Janne Grunau) - drm: apple: dptx: Configure number of lanes for dptx-phy (Janne Grunau) - fixup! drm: apple: Add DPTX support (Janne Grunau) - drm: apple: HDMI: Check HPD state before enabling the IRQ (Janne Grunau) - drm: apple: dptx: Rework/document get_max_lane_count() (Janne Grunau) - drm: apple: iomfb: Adapt `IOMFB_METHOD` for gcc 15 (Janne Grunau) - fixup! WIP: drm/apple: Add DCP display driver (Asahi Lina) - drm: apple: audio: Rework audio service handling (Janne Grunau) - drm: apple: afk: Allow replies after service 'teardown' (Janne Grunau) - drm: apple: dptx: Tidy up lane count handling (Janne Grunau) - drm: apple: dptx: Silence DPTX_APCALL_{GET,SET}_DOWN_SPREAD (Janne Grunau) - drm: apple: Handle dcps with "phys" property as dcpext (Janne Grunau) - drm: apple: Support up to 3 DCP instances. (Janne Grunau) - drm: apple: Revert "Use delayed work for debounced oob HPD" (Janne Grunau) - drm: apple: Use delayed work for debounced oob HPD (Janne Grunau) - drm: apple: iomfb: Clear non-visible planes (Janne Grunau) - drm: apple: Use dest rct in offscreen test (Janne Grunau) - drm: apple: refactor apple_plane_atomic_check (Janne Grunau) - fixup! drm: apple: add support for overlay planes (Janne Grunau) - drm: apple: make plane zpos immutable (James Calligeros) - drm: apple: warn about broken sw cursor fallback (James Calligeros) - drm: apple: use correct min/max plane scaling factors (James Calligeros) - drm: apple: add support for overlay planes (James Calligeros) - drm: apple: reject plane commit if it will crash DCP (James Calligeros) - drm: apple: constrain swaps to maximum blendable surfaces (James Calligeros) - drm: apple: respect drm_plane_state zpos (James Calligeros) - drm: apple: Add .get_scanout_buffer for drm_panic support (Janne Grunau) - drm: apple: Add CRTC CRC support (Janne Grunau) - fixup! mux: apple dp crossbar: Support t602x DP cross bar variant (Janne Grunau) - drm: apple: audio: Implement runtime PM support (Janne Grunau) - fixup! drm/apple: audio: Create a device link to the DMA device (Janne Grunau) - drm: apple: Enable EDID support by default (Janne Grunau) - fixup! mux: apple dp crossbar: Support t602x DP cross bar variant (Janne Grunau) - fixup! mux: apple dp crossbar: Support t602x DP cross bar variant (Janne Grunau) - fixup! mux: apple dp crossbar: Support t602x DP cross bar variant (Janne Grunau) - fixup! mux: apple dp crossbar: Support t602x DP cross bar variant (Janne Grunau) - ALSA: Introduce 'snd_interval_rate_bits' (Martin Povišer) - drm: apple: iomfb: Provide the EDID as connector property (Janne Grunau) - drm: apple: Add dcpav-service-ep (Janne Grunau) - drm: apple: afk: Optionally match against EPICName (Janne Grunau) - Revert "drm: apple: HACK: Do not delete piodma platform device" (Janne Grunau) - drm: apple: iomfb: Align buffer size on unmap/free as well (Janne Grunau) - drm/apple: Fix missing mode init (feel free to squash) (Asahi Lina) - drm: apple: dptxport: get_max_lane_count: Retrieve lane count from phy (Janne Grunau) - drm: apple: dptx: Fix get_drive_settings retcode (Janne Grunau) - drm: apple: Add oob hotplug event (Sven Peter) - drm/apple: audio: Fix hotplug notifications (Asahi Lina) - drm/apple: audio: Defer DMA channel acquisition to device open (Asahi Lina) - drm/apple: audio: Create a device link to the DMA device (Asahi Lina) - drm/apple: Explicitly stop AFK endpoints on shutdown (Asahi Lina) - drm: apple: Override drm_vblank's page flip event handling [HACK] (Janne Grunau) - drm: apple: disable HDMI audio by default (Janne Grunau) - drm: apple: av: Warn only once about failed calls (Janne Grunau) - drm: apple: Reduce log spam about busy command channel (Janne Grunau) - drm: apple: Fix broken MemDescRelay::release_descriptor callback number (Janne Grunau) - drm: apple: Switch back to drm_atomic_helper_commit_tail_rpm() (Janne Grunau) - drm: apple: backlight: release lock in error path (Caspar Schutijser) - drm/apple: fix double words in comments (Jonathan Gray) - drm: apple: audio: Avoid probe errors (Janne Grunau) - drm: apple: audio: Make the DP/HDMI audio driver a full driver (Janne Grunau) - drm: apple: audio: move the audio driver into the DCP module (Janne Grunau) - drm: apple: av: Use a workqueue (Janne Grunau) - drm: apple: audio: init AV endpoint later (Janne Grunau) - drm: apple: dptx: Remove DPTX disconnect/connect on init (Janne Grunau) - gpu: drm: apple: Add DCP audio driver (Martin Povišer) - drm: apple: av: Do not open AV service from afk receive handler (Janne Grunau) - drm: apple: av: Support macOS 12.3 and 13.5 firmware APIs (Janne Grunau) - gpu: drm: apple: Set up client of AV endpoint (Martin Povišer) - gpu: drm: apple: Expose injecting of EPIC calls via debugfs (Martin Povišer) - drm: apple: iomfb: export property dicts in connector debugfs (Janne Grunau) - drm: apple: Add Kconfig option for audio (Janne Grunau) - drm: apple: dptx: Debounce HPD by simple msleep() (Janne Grunau) - drm: apple: Fix/remove log messages (Janne Grunau) - drm: apple: backlight: force backlight update after resume (Mark Kettenis) - drm/apple: spelling fixes (Jonathan Gray) - drm/apple: Add missing RTKit Kconfig dependency (Alyssa Ross) - drm: apple: mark local functions static (Arnd Bergmann) - drm: apple: epic: systemep: Parse "mNits" log events (Janne Grunau) - drm: apple: epic: Pass full notfiy/report payload to handler (Janne Grunau) - drm: apple: parser: constify parser data (Janne Grunau) - drm: apple: iomfb: Always parse DisplayAttributes (Janne Grunau) - drm: apple: Prefer RGB SDR modes (Janne Grunau) - drm: apple: dptx: Wait for link config on connect (Janne Grunau) - drm: apple: Be less noisy about teardown notifies without service (Janne Grunau) - drm: apple: dcp: Fix resume with DPTX based display outputs (Janne Grunau) - drm: apple: Adjust startup sequence and timing for dptx (Janne Grunau) - drm: apple: iomfb: Extend hotplug/mode parsing logging (Janne Grunau) - drm : apple: iomfb: Handle OOB ASYNC/CB context (Janne Grunau) - drm: apple: iomfb: Use drm_kms_helper_connector_hotplug_event (Janne Grunau) - drm: apple: Fix DPTX hotplug handling (Janne Grunau) - drm: apple: Move modeset into drm_crtc's atomic_enable (Janne Grunau) - drm: apple: dptx: Log connect/disconnect calls (Janne Grunau) - drm: apple: Extract modeset crtc's atomic_flush() (Janne Grunau) - drm: apple: iomfb: Improve hotplug related logging (Janne Grunau) - drm: apple: HPD: Only act on connect IRQs (Janne Grunau) - drm: apple: dptx: Wait for completion of dptx_connect. (Janne Grunau) - drm: apple: Disconnect dptx When the CRTC is powered down (Janne Grunau) - drm: apple: dptx: Implement APCALL_DEACTIVATE and reset the phy (Janne Grunau) - Revert "drm: apple: iomfb: Do not match/create PMU service for dcpext" (Janne Grunau) - drm: apple: Keep information at which swap_id fb are still referenced (Janne Grunau) - drm: apple: Implement D592 callback (Janne Grunau) - drm: apple: afk: Update read pointer before processing message (Janne Grunau) - drm: apple: HACK: Do not delete piodma platform device (Janne Grunau) - drm/apple: Add missing sound Kconfig dependencies (Asahi Lina) - drm: apple: dptxep: Implement drive settings stuff (Hector Martin) - drm: apple: dptxep: Fix reply size check (Hector Martin) - drm: apple: Fix missing unlock path in dcp_dptx_connect (Hector Martin) - drm: apple: afk: Clear commands before sending them (Hector Martin) - drm: apple: dptx: Adapt dptxport_connect() to observed behavior (Janne Grunau) - drm: apple: dptx: Add DPTX_APCALL_ACTIVATE (Janne Grunau) - drm: apple: dptx: Add set_active_lanes APCALL (Janne Grunau) - drm: apple: dptx: port interface to macOS 13.5 firmware (Janne Grunau) - drm: apple: dptx: Port APCALL to macOS 13.3 firmware (Janne Grunau) - drm: apple: afk: Adapt to macOS 13.3 firmware (Janne Grunau) - drm: apple: iomfb: Do not match/create PMU service for dcpext (Janne Grunau) - drm: apple: Move offsets for rt_bandwidth callback to DT (Janne Grunau) - drm: apple: Add DPTX support (Sven Peter) - drm: apple: afk: Use linear array of services (Janne Grunau) - drm: apple: DCP AFK/EPIC support (Sven Peter) - gpu: drm: apple: Add sound mode parsing (Martin Povišer) - gpu: drm: apple: Add 'parse_blob' (Martin Povišer) - gpu: drm: apple: Add utility functions for matching on dict keys (Martin Povišer) - mux: apple dp crossbar: Support t602x DP cross bar variant (Janne Grunau) - mux: apple dp crossbar: Read UNK_TUNABLE before and after writing it (Janne Grunau) - mux: apple dp crossbar: FIFO_RD_UNK_EN seems to use 2 bits per dispext* (Janne Grunau) - mux: apple dp crossbar: Support t8112 varient (Janne Grunau) - mux: apple DP xbar: Add Apple silicon DisplayPort crossbar (Sven Peter) - drm: apple: Remove explicit asc-dram-mask handling (Janne Grunau) - drm: apple: iomfb: Increase modeset tiemout to 8.5 seconds (Janne Grunau) - drm: apple: iomfb: implement abort_swaps_dcp (Janne Grunau) - drm: apple: dcp: Remove cargo-culted devm_of_platform_populate (Janne Grunau) - drm: apple: dcp: Port over to DEFINE_SIMPLE_DEV_PM_OPS (Janne Grunau) - drm: apple: Update supported firmware versions to 12.3 and 13.5 (Janne Grunau) - drm: apple: Add D129 allocate_bandwidth iomfb callback (Janne Grunau) - drm: apple: Align PIODMA buffers to SZ_16K (Janne Grunau) - fixup! drm/apple: Use iommu domain for piodma maps (Janne Grunau) - drm/apple: Use iommu domain for piodma maps (Janne Grunau) - drm/apple: Get rid of the piodma dummy driver (Janne Grunau) - drm: apple: backlight: avoid updating the brightness with a commit (Janne Grunau) - drm: apple: iomfb: limit backlight updates to integrated panels (Janne Grunau) - drm: apple: Only match backlight service on DCP with panel (Janne Grunau) - drm: apple: iomfb: Increase modeset timeout to 2.5 seconds (Janne Grunau) - drm/apple: Mark DCP as being in the wakeup path (Hector Martin) - drm/apple: Remove simpledrm framebuffer before DRM device alloc (Janne Grunau) - WIP: drm/apple: Port to incompatible V13.3 firmware interface (Janne Grunau) - dcp: Warn if DMA mapping fails (Hector Martin) - dcp: T602X bwreq support (Hector Martin) - dcp: 42-bit DMA masks (Hector Martin) - dcp: Add get_tiling_state (Hector Martin) - dcp: Allow unused trampolines (Hector Martin) - drm/apple: Drop unsupported DRM_FORMAT_ARGB2101010 (Janne Grunau) - drm/apple: Support color transformation matrices (Janne Grunau) - drm/apple: ignore surf[3] in clear swap calls (Janne Grunau) - drm/apple: Add support for the macOS 13.2 DCP firmware (Janne Grunau) - drm/apple: Add callbacks triggered by last_client_close_dcp() (Janne Grunau) - drm/apple: purge unused dcp_update_notify_clients_dcp (Janne Grunau) - drm/apple: Align buffers to 16K page size (Asahi Lina) - drm/apple: Move panel options to its own sub-struct (Janne Grunau) - drm/apple: Use backlight_get_brightness() (Janne Grunau) - drm/apple: Set backlight level indirectly if no mode is set (Janne Grunau) - drm/apple: Fix bad error return (Asahi Lina) - drm/apple: Fix parse_string() memory leaks (Asahi Lina) - drm/apple: simplify IOMFB_THUNK_INOUT (Janne Grunau) - gpu: drm: apple: Wait for iomfb initialization (Janne Grunau) - gpu: drm: apple: Use components to avoid deferred probing (Janne Grunau) - drm/apple: Allocate drm objects according to drm's expectations (Janne Grunau) - drm/apple: Use drm_module_platform_driver (Janne Grunau) - squash! gpu: drm: apple: Use drm_aperture_remove_conflicting_framebuffers (Janne Grunau) - gpu: drm: apple: Use drm_aperture_remove_conflicting_framebuffers (Janne Grunau) - drm/apple: Update swap handling (Janne Grunau) - gpu: drm: apple: Clear all surfaces on startup (Janne Grunau) - drm/apple: Enable 10-bit mode & set colorspace to native (Hector Martin) - Revert "gpu: drm: apple: reenable support for {A,X}RGB2101010" (Janne Grunau) - gpu: drm: apple: Add show_notch module parameter (Janne Grunau) - gpu: drm: apple: reenable support for {A,X}RGB2101010 (Janne Grunau) - gpu: drm: apple: Add IOMobileFramebufferAP::get_color_remap_mode (Janne Grunau) - gpu: drm: apple: Prefer SDR color modes (Janne Grunau) - gpu: drm: apple: Add tracing for color and timing modes (Janne Grunau) - gpu: drm: apple: Skip parsing elements of virtual timing modes (Janne Grunau) - gpu: drm: apple: Parse color modes completely (Janne Grunau) - drm/apple: Disable fake vblank IRQ machinery (Asahi Lina) - drm/apple: Check if DCP firmware is supported (Janne Grunau) - drm/apple: Report "PMUS.Temperature" only for mini-LED backlights (Janne Grunau) - drm/apple: Schedule backlight update on enable_backlight_message_ap_gated (Janne Grunau) - drm/asahi: Fix backlight restores on non-microLED devices (Asahi Lina) - drm/apple: Remove obsolete ignore_swap_complete (Asahi Lina) - drm/apple: Wait for power on request to complete synchronously (Asahi Lina) - drm/apple: Read display dimensions from devicetree (Janne Grunau) - drm/apple: Implement drm_crtc_helper_funcs.mode_fixup (Janne Grunau) - drm/apple: Add trace point for display brightness (Janne Grunau) - drm/apple: register backlight device after IOMFB start (Janne Grunau) - gpu: drm: apple: Avoid drm_fb_dma_get_gem_addr (Janne Grunau) - drm/apple: Fix suspend/resume handling (Hector Martin) - HACK: gpu: drm: apple: j314/j316: Ignore 120 Hz mode for integrated display (Janne Grunau) - gpu: drm: apple: Brightness control via atomic commits (Janne Grunau) - gpu: drm: apple: "match" PMU/backlight services on init (Janne Grunau) - gpu: drm: apple: iomfb: Unify call and callback channels (Janne Grunau) - gpu: drm: apple: iomfb: Use FIELD_{GET,PREP} (Janne Grunau) - gpu: drm: apple: Update date last update (Janne Grunau) - gpu: drm: apple: Prevent NULL pointer in dcp_hotplug (Janne Grunau) - gpu: drm: apple: Set maximal framebuffer size correctly (Janne Grunau) - gpu: drm: apple: Fix shutdown of partially probed dcp (Janne Grunau) - gpu: drm: apple: Provide notch-less modes (Janne Grunau) - gpu: drm: apple: Support opaque pixel formats (Janne Grunau) - gpu: drm: apple: Remove other framebuffers before DRM setup (Janne Grunau) - gpu: drm: apple: Specify correct number of DCP*s for drm_vblank_init (Janne Grunau) - gpu: drm: apple: Fix DCP initialisation (Janne Grunau) - gpu: drm: apple: Fix DCP run time PM (Janne Grunau) - gpu: drm: apple: Add dcp_crtc_atomic_check (Janne Grunau) - gpu: drm: apple: Send an disconnected hotplug event on ASC crash (Janne Grunau) - gpu: drm: apple: Convert 2 non-assert WARN()s to dev_err() (Janne Grunau) - gpu: drm: apple: Reject modes without valid color mode (Janne Grunau) - gpu: drm: apple: Add apple_drm_gem_dumb_create() (Janne Grunau) - gpu: drm: apple: Add support for DRM_FORMAT_XRGB2101010 (Janne Grunau) - gpu: drm: apple: Unbreak multiple DCP plane <-> crtc matching (Janne Grunau) - gpu: drm: apple: Start using tracepoints (Janne Grunau) - drm: apple: Replace atomic refcount with kref (Janne Grunau) - drm: apple: Fix connector state on devices with integrated display (Janne Grunau) - gpu: drm: apple: Use connector types from devicetree (Janne Grunau) - WIP: add header test target copied from i915 (Janne Grunau) - drm/apple: Split dcpep/iomfb out of dcp.c (Janne Grunau) - drm/apple: make note about drm.mode_config.max_width/height (Janne Grunau) - drm/apple: Mark the connecter on init only with modes as connected (Janne Grunau) - drm/apple: Allow modesets even when disconnected (Janne Grunau) - drm/apple: Fix kzalloc in dcp_flush() (Asahi Lina) - drm/apple: laod piodma dev via explicit phandle (Janne Grunau) - WIP: drm/apple: Change the way to clear unused surfaces (Janne Grunau) - drm/apple: Support memory unmapping/freeing (Janne Grunau) - drm/apple: clear callback's output data (Janne Grunau) - drm/apple: implement read_edt_data (Janne Grunau) - drm/apple: Add less tons of questionable debug prints (Janne Grunau) - drm/apple: Add somewhat useful debug prints (Janne Grunau) - drm/apple: toggle power only when active state changes (Janne Grunau) - drm/apple: Add t600x support (Janne Grunau) - drm/apple: Clear used callback/cookie on dcp_ack (Janne Grunau) - drm/apple: Add DCP interface definitions used on t600x (Janne Grunau) - drm/apple: Log callbacks with their tag as debug output (Janne Grunau) - drm/apple: Switch to nonblocking commit handling (Janne Grunau) - drm/apple: dcp: fix TRAMPOLINE_IN macro (Janne Grunau) - drm/apple: Implement suspend/resume for DCP (Alyssa Rosenzweig) - drm/apple: Use "apple,asc-dram-mask" for rtkit iovas (Janne Grunau) - drm/apple: Reference only swapped out framebuffers (Janne Grunau) - drm/apple: Add nop sr_set_uint_prop callback for t600x-dcp (Janne Grunau) - drm/apple: Fix rt_bandwidth for t600x (Janne Grunau) - drm/apple: Use a device tree defined clock for dcpep_cb_get_frequency (Janne Grunau) - HACK: drm/apple: avoid DCP swaps without attached surfaces (Janne Grunau) - drm/apple: Start coprocessor on probe (Janne Grunau) - drm: apple: Relicense DCP driver as dual MIT / GPL v2.0 (Janne Grunau) - WIP: drm/apple: Add DCP display driver (Alyssa Rosenzweig) - rust: helpers: Add dma_mapping_error() helper (Sasha Finkelstein) - rust: io: Add helper for memcpy_toio (Sasha Finkelstein) - Rust: io: Add memcpy_fromio wrapper (Asahi Lina) - rust: kernel: {arc, kbox}: use pin_coerce_unsized_trait (Janne Grunau) - rust: add unstable feature associated_type_defaults (Janne Grunau) - rust: Enable clippy::undocumented_unsafe_blocks lint (Asahi Lina) - rust: kernel: workqueue: Disable clippy::undocumented_unsafe_blocks lint (Asahi Lina) - rust: print: Disable clippy::undocumented_unsafe_blocks lint (Asahi Lina) - rust: init: macros: Disable clippy::undocumented_unsafe_blocks lint (Asahi Lina) - rust: init: Disable clippy::undocumented_unsafe_blocks lint (Asahi Lina) - rust: init: Add default() utility function (Asahi Lina) - rust: bindgen: Exclude list functions with unsupported ABIs (Asahi Lina) - rust: of: Add wrapper for of_property_present() (Janne Grunau) - rust: of: Add Node::address_as_resource() (Asahi Lina) - rust: page: Add physical address conversion functions (Asahi Lina) - rust: addr: Add a module to declare core address types (Asahi Lina) - rust: page: Make with_page_mapped() and with_pointer_into_page() public (Asahi Lina) - rust: page: Convert to Ownable (Asahi Lina) - rust: Add Ownable/Owned types (Asahi Lina) - HACK: rust: of: add as_raw() (Janne Grunau) - rust: of: Add parse_phandle_by_name() (Janne Grunau) - rust: Fix x86 build (Hector Martin) - rust: of: Add OF node abstraction (Asahi Lina) - rust: device: Add Device::parent() (Sasha Finkelstein) - rust: soc: apple: rtkit: Add Apple RTKit abstraction (Asahi Lina) - rust: xarray: Add an abstraction for XArray (Asahi Lina) - *RFL import: kernel::delay (Asahi Lina) - rust: Add time_namespace helpers (Asahi Lina) - rust: time: New module for timekeeping functions (Asahi Lina) - rust: sync: arc: Add lockdep integration (Asahi Lina) - rust: sync: Add LockdepMap abstraction (Asahi Lina) - rust: init: Update documentation for new mutex init style (Asahi Lina) - rust: sync: Classless Lock::new() and pin_init() (Asahi Lina) - rust: sync: Implement dynamic lockdep class creation (Asahi Lina) - rust: sync: Replace static LockClassKey refs with a pointer wrapper (Asahi Lina) - rust: sync: Add dummy LockClassKey implementation for !CONFIG_LOCKDEP (Asahi Lina) - Revert "rust: lockdep: Remove support for dynamically allocated LockClassKeys" (Janne Grunau) - rust: kernel: Add simple siphash abstraction (Asahi Lina) - rust: Use absolute paths to build Rust objects (Asahi Lina) - rust: types: Add Opaque::zeroed() (Asahi Lina) - rust: init: Support type paths in pin_init!() and friends (Asahi Lina) - rust: init: Implement Zeroable::zeroed() (Asahi Lina) - rust: kernel: lock: Add Lock::pin_init() (Asahi Lina) - rust: str: allow dereferencing BStr in a const ctx (Fabien Parent) - rust: alloc: Flags: Switch to declare_flags_type!() macro. (Asahi Lina) - rust: types: Add declare_flags_type() (Asahi Lina) - rust: alloc: Add .resize() to Vec (Sasha Finkelstein) - rust: alloc: vec: Import .drain() / Drain from rust library (Janne Grunau) - rust: alloc: vec: Add TryFrom trait (Janne Grunau) - rust: alloc: Vec: Implement .clear()/.truncate() (Janne Grunau) - rust: alloc: kbox: Add CoerceUnsized trait (Janne Grunau) - rust: alloc: kbox: Add AsRef implementation to Box (Sasha Finkelstein) - rust: allocator: Disable clippy::undocumented_unsafe_blocks lint (Asahi Lina) - rust: Add a Sealed trait (Asahi Lina) - rust: error: Add ENOSYS from uapi/asm-generic/errno.h (Janne Grunau) - rust: error: Add ECANCELED from uapi/asm-generic/errno.h (Janne Grunau) - rust: error: Add ENODATA from uapi/asm-generic/errno.h (Janne Grunau) - rust: error: Add ETIMEDOUT from uapi/asm-generic/errno.h (Janne Grunau) - rust: dma: add as_slice/write functions for CoherentAllocation (Abdiel Janulgue) - rust: platform: implement the `dma::Device` trait (Danilo Krummrich) - rust: pci: implement the `dma::Device` trait (Danilo Krummrich) - rust: dma: add dma addressing capabilities (Danilo Krummrich) - rust: dma: implement `dma::Device` trait (Danilo Krummrich) - modules: add rust modules files to MAINTAINERS (Andreas Hindborg) - rust: add parameter support to the `module!` macro (Andreas Hindborg) - rust: str: add radix prefixed integer parsing functions (Andreas Hindborg) - rust: io: mem: Add Mem abstraction (Asahi Lina) - rust: io: mem: Support non-posted write semantics (Janne Grunau) - rust: io: resource: Add resource flag IORESOURCE_MEM_NONPOSTED (Janne Grunau) - rust: io: add resource abstraction (ffi fixes) (Janne Grunau) - rust: platform: allow ioremap of platform resources (Daniel Almeida) - rust: io: mem: add a generic iomem abstraction (Daniel Almeida) - rust: io: add resource abstraction (Daniel Almeida) - rust: str: implement `strip_prefix` for `BStr` (Andreas Hindborg) - rust: str: implement `AsRef` for `[u8]` and `BStr` (Andreas Hindborg) - rust: str: implement `Index` for `BStr` (Andreas Hindborg) - rust: str: implement `PartialEq` for `BStr` (Andreas Hindborg) - MAINTAINERS: add entry for Rust dma mapping helpers device driver API (Abdiel Janulgue) - rust: add dma coherent allocator abstraction (Abdiel Janulgue) - rust: error: Add EOVERFLOW (Abdiel Janulgue) - rust: module: introduce `authors` key (Guilherme Giacomo Simoes) - panic_qr: use new #[export] macro (Alice Ryhl) - print: use new #[export] macro for rust_fmt_argument (Alice Ryhl) - rust: add #[export] macro (Alice Ryhl) - rust: macros: support additional tokens in quote! (Alice Ryhl) - rust: fix signature of rust_fmt_argument (Alice Ryhl) - devres: add devm_remove_action_nowarn() (Danilo Krummrich) - rust: device: Use as_char_ptr() to avoid explicit cast (Viresh Kumar) - rust: device: Replace CString with CStr in property_present() (Viresh Kumar) - rust: device: Add property_present() (Viresh Kumar) - rust: devres: remove action in `Devres::drop` (Danilo Krummrich) - miscdevice: rust: use build_error! macro instead of function (Alice Ryhl) - rust: driver: address soundness issue in `RegistrationOps` (Danilo Krummrich) - rust: io: move module entry to its correct location (Danilo Krummrich) - rust: pci: do not depend on CONFIG_PCI_MSI (Danilo Krummrich) - rust: platform: add basic platform device / driver abstractions (Danilo Krummrich) - rust: driver: implement `Adapter` (Danilo Krummrich) - rust: of: add `of::DeviceId` abstraction (Danilo Krummrich) - rust: pci: implement I/O mappable `pci::Bar` (Danilo Krummrich) - rust: pci: add basic PCI device / driver abstractions (Danilo Krummrich) - rust: add devres abstraction (Danilo Krummrich) - rust: add `io::{Io, IoRaw}` base types (Danilo Krummrich) - rust: add `Revocable` type (Wedson Almeida Filho) - rust: types: add `Opaque::pin_init` (Danilo Krummrich) - rust: add rcu abstraction (Wedson Almeida Filho) - rust: implement `IdArray`, `IdTable` and `RawDeviceId` (Danilo Krummrich) - rust: implement generic driver registration (Danilo Krummrich) - rust: module: add trait `ModuleMetadata` (Danilo Krummrich) - rust: miscdevice: add fops->show_fdinfo() hook (Alice Ryhl) - rust: miscdevice: Provide accessor to pull out miscdevice::this_device (Lee Jones) - rust: miscdevice: access the `struct miscdevice` from fops->open() (Alice Ryhl) - rust: miscdevice: access file in fops (Alice Ryhl) - kbuild: rust: add PROCMACROLDFLAGS (HONG Yifan) - rust: uaccess: generalize userSliceReader to support any Vec (Filipe Xavier) - rust: kernel: add improved version of `ForeignOwnable::borrow_mut` (Alice Ryhl) - rust: kernel: reorder `ForeignOwnable` items (Tamir Duberstein) - rust: kernel: change `ForeignOwnable` pointer to mut (Tamir Duberstein) - rust: arc: split unsafe block, add missing comment (Tamir Duberstein) - rust: types: avoid `as` casts (Tamir Duberstein) - rust: arc: use `NonNull::new_unchecked` (Tamir Duberstein) - rust: use derive(CoercePointee) on rustc >= 1.84.0 (Xiangfei Ding) - rust: alloc: add doctest for `ArrayLayout::new()` (Jimmy Ostler) - rust: init: update `stack_try_pin_init` examples (Jimmy Ostler) - rust: error: import `kernel`'s `LayoutError` instead of `core`'s (Jimmy Ostler) - rust: str: replace unwraps with question mark operators (Daniel Sedlak) - rust: page: remove unnecessary helper function from doctest (Daniel Sedlak) - rust: rbtree: remove unwrap in asserts (Daniel Sedlak) - rust: init: replace unwraps with question mark operators (Daniel Sedlak) - rust: use host dylib naming convention to support macOS (Tamir Duberstein) - rust: add `build_error!` to the prelude (Miguel Ojeda) - rust: kernel: move `build_error` hidden function to prevent mistakes (Miguel Ojeda) - rust: use the `build_error!` macro, not the hidden function (Miguel Ojeda) - rust: kbuild: run Clippy for `rusttest` code (Miguel Ojeda) - rust: give Clippy the minimum supported Rust version (Miguel Ojeda) - rust: document `bindgen` 0.71.0 regression (Miguel Ojeda) - rust: alloc: align Debug implementation for Box with Display (Guangbo Cui) - rust: alloc: implement Display for Box (Guangbo Cui) - rust: sync: document `PhantomData` in `Arc` (Tamir Duberstein) - rust: workqueue: Enable execution of doctests (Dirk Behme) - rust: error: modify `from_errno` to use `try_from_errno` (Daniel Sedlak) - dmaengine: apple-sio: Implement runtime PM (Janne Grunau) - dmaengine: apple-sio: Fix chan freeing in error path (Asahi Lina) - dmaengine: apple-sio: Add Apple SIO driver (Martin Povišer) - dt-bindings: dma: apple,sio: Add schema (Martin Povišer) - phy: apple: atc: Ensure DP mode is used for DP-only ATC phys (Janne Grunau) - phy: apple: atc: Add missing mutex_unlock in error case (Janne Grunau) - phy: apple: dptx: Add debug prints for unexpected values (Janne Grunau) - phy: apple: atc: support mode switches in atcphy_dpphy_set_mode() (Janne Grunau) - HACK: phy: apple: atc: Ignore fake submodes (Janne Grunau) - phy: apple: atc: Support 'set_lanes' in DP mode (Janne Grunau) - phy: apple: atc: Support DisplayPort only operation (Janne Grunau) - phy: apple: atc: Reorder ACIOPHY_CROSSBAR and ACIOPHY_MISC ops (Janne Grunau) - phy: apple: atc: Split atcphy_dp_configure_lane() (Janne Grunau) - phy: apple: Add DP TX phy driver (Janne Grunau) - usb: typec: tipd: Clear interrupts first (Sven Peter) - WIP: phy: apple: Add Apple Type-C PHY (Sven Peter) - nvmem: round up to word_size (Sven Peter) - nvmem: allow bit offset > 8 (Sven Peter) - Revert "nvmem: core: Print error on wrong bits DT property" (Janne Grunau) - xhci-pci: asmedia: Add a firmware loader for ASM2214a chips (Hector Martin) - PCI: apple: Avoid PERST# deassertion through gpiod initialization (Janne Grunau) - fixup! PCI: apple: Move port PHY registers to their own reg items (Janne Grunau) - PCI: apple: Do not power down devices on port setup (Hector Martin) - PCI: apple: Log the time it takes for links to come up (Hector Martin) - PCI: apple: Reorder & improve link-up logic (Hector Martin) - PCI: apple: Make link up timeout configurable, default to 500ms (Hector Martin) - PCI: apple: Skip controller port setup for online links (Janne Grunau) - PCIE: apple: Add T602x PCIe support (Hector Martin) - PCI: apple: Drop poll for CORE_RC_PHYIF_STAT_REFCLK (Hector Martin) - PCI: apple: Move port PHY registers to their own reg items (Hector Martin) - PCI: apple: Set only available ports up (Janne Grunau) - PCI: apple: Fix missing OF node reference in apple_pcie_setup_port (Hector Martin) - PCI: apple: Add support for optional PWREN GPIO (Hector Martin) - PCI: apple: Probe all GPIOs for availability first (Hector Martin) - PCI: apple: Use gpiod_set_value_cansleep in probe flow (Hector Martin) - dt-bindings: pci: apple,pcie: Add subnode binding, pwren-gpios property (Hector Martin) - cpufreq: apple-soc: Drop setting the PS2 field on M2+ (Hector Martin) - nvmem: spmi-mfd-nvmem: use legacy fixed layout (Janne Grunau) - nvmem: Add spmi-mfd-nvmem driver (Hector Martin) - mfd: Add a simple-mfd-spmi driver (Hector Martin) - spmi: add a first basic spmi driver for Apple SoC (Jean-Francois Bortolotti) - hwmon: macsmc: wire up manual fan control support (James Calligeros) - platform/apple: smc: Add apple_smc_write_f32_scaled (Janne Grunau) - power: supply: macsmc_power: Report not charging for CHLS thresholds (Janne Grunau) - power: supply: macsmc_power: Remove CSIL (Hector Martin) - power: supply: macsmc_power: Add CHLS charge thresholds (Hector Martin) - hwmon: macsmc: Avoid global writable hwmon_chip_info (Janne Grunau) - hwmon: add macsmc-hwmon driver (James Calligeros) - platform/apple: smc: Add apple_smc_read_ioft_scaled (Janne Grunau) - power: supply: macsmc_power: Add more properties (Hector Martin) - power: supply: macsmc_power: Report available charge_behaviours (Thomas Weißschuh) - power: supply: macsmc_power: Add CHWA charge thresholds (Hector Martin) - power: supply: macsmc_power: Log power data on button presses (Hector Martin) - macsmc: Fix race between backend and core on notifications (Hector Martin) - power: supply: macsmc_power: Add a debug mode to print power usage (Hector Martin) - platform/apple: smc: Add apple_smc_read_f32_scaled (Hector Martin) - power: supply: macsmc_power: Add critical level shutdown & misc events (Hector Martin) - Input: macsmc-hid: Support the power button on desktops (Hector Martin) - gpio: macsmc: Add IRQ support (Hector Martin) - Input: macsmc-hid: Support button/lid wakeups (Hector Martin) - Input: macsmc-hid: New driver to handle the Apple Mac SMC buttons/lid (Hector Martin) - rtc: Add new rtc-macsmc driver for Apple Silicon Macs (Hector Martin) - power: reset: macsmc-reboot: Add driver for rebooting via Apple SMC (Hector Martin) - power: supply: macsmc_power: Add AC power supply (Hector Martin) - power: supply: macsmc_power: Turn off OBC flags if macOS left them on (Hector Martin) - power: supply: macsmc_power: Use BUIC instead of BRSC for charge (Hector Martin) - power: supply: macsmc_power: Add more props, rework others (Hector Martin) - power: supply: macsmc_power: Add present prop (Hector Martin) - power: supply: macsmc_power: Add cycle count and health props (Hector Martin) - power: supply: macsmc_power: Driver for Apple SMC power/battery stats (Hector Martin) - gpio: Add new gpio-macsmc driver for Apple Macs (Hector Martin) - platform/apple: Add new Apple Mac SMC driver (Hector Martin) - lib/vsprintf: Add support for generic FOURCCs by extending %p4cc (Hector Martin) - HID: transport: spi: apple: Use distinctive names input devices (Janne Grunau) - HID: transport: spi: apple: Increase receive buffer size (Janne Grunau) - HID: magicmouse: Query device dimensions via HID report (Hector Martin) - HID: transport: spi: Implement GET FEATURE (Hector Martin) - HID: magicmouse: Handle touch controller resets on SPI devices (Hector Martin) - HID: Bump maximum report size to 16384 (Hector Martin) - HID: transport: spi: Add suspend support (Janne Grunau) - HID: magicmouse: Add .reset_resume for SPI trackpads (Janne Grunau) - HID: transport: spi: Check status message after transmits (Janne Grunau) - soc: apple: Add RTKit helper driver (Hector Martin) - hid: Add Apple DockChannel HID transport driver (Hector Martin) - soc: apple: Add DockChannel driver (Hector Martin) - hid: magicmouse: Add MTP multi-touch device support (Hector Martin) - hid: apple: Bind to HOST devices for MTP (Hector Martin) - HID: core: Handle HOST bus type when announcing devices (Hector Martin) - HID: add HOST vendor/device IDs for Apple MTP devices (Hector Martin) - WIP: HID: transport: spi: add Apple SPI transport (Janne Grunau) - HID: magicmouse: add support for Macbook trackpads (Janne Grunau) - HID: magicmouse: use ops function pointers for input functionality (Janne Grunau) - HID: magicmouse: use struct input_mt_pos for X/Y (Janne Grunau) - HID: magicmouse: use a define of the max number of touch contacts (Janne Grunau) - HID: apple: add Fn key mapping for Macbook Pro with touchbar (Janne Grunau) - HID: apple: add Fn key mapping for Apple silicon MacBooks (Janne Grunau) - HID: apple: add support for internal keyboards (Janne Grunau) - HID: add device IDs for Apple SPI HID devices (Janne Grunau) - fixup! wifi: brcmfmac: Add support for firmware signatures (Janne Grunau) - [brcmfmac] Disable partial SAE offload (Daniel Berlin) - [brcmfmac] Clean up and common interface creation handling (Daniel Berlin) - [brcmfmac] Support bandwidth caps for all bands (Daniel Berlin) - [brcmfmac] Add support for more rate info in station dumps (Daniel Berlin) - [brcmfmac] Set chanspec during join. (Daniel Berlin) - [brcmfmac] Add support for more auth suites in roaming offload (Daniel Berlin) - [brcmfmac] Let feature attachment fail, and fail if we can't handle the interface versions we find. (Daniel Berlin) - [brcmfmac] Support new join parameter structure versions (Hector Martin) - [brcmfmac] Structurize scan parameter handling (Daniel Berlin) - [brcmfmac] Structurize PNF scan and add support for latest version (Daniel Berlin) - fixup! define missing event message extension (Daniel Berlin) - fixup! fix FWIL definition to use SSID length constant (Daniel Berlin) - [brcmfmac] Fix regulatory domain handling to reset bands properly (Daniel Berlin) - [brcmfmac] Add support for 6G bands and HE (Daniel Berlin) - [brcmfmac] Support high power/low power/etc scan flags (Daniel Berlin) - [brcmfmac] Don't issue wrong insufficient headroom warning (Daniel Berlin) - [brcmfmac] Support GCMP cipher suite, used by WPA3. (Daniel Berlin) - [brcmfmac] Compute number of available antennas and set it in wiphy structure. (Daniel Berlin) - [brcmfmac] Dynamically configure VHT settings to match firmware (Daniel Berlin) - [brcmfmac] Add support for encoding/decoding 6g chanspecs (Daniel Berlin) - [brcmfmac] Finish firmware mem map, fix heap start calculation bug. (Daniel Berlin) - brcmfmac: Fix AP mode (Patrick Blass) - wifi: brcmfmac: Add BCM4388 support (Hector Martin) - wifi: brcmfmac: Extend brcmf_wsec_pmk_le (Hector Martin) - wifi: brcmfmac: Support bss_info up to v112 (Hector Martin) - wifi: brcmfmac: Implement event_msgs_ext (Hector Martin) - wifi: brcmfmac: Add support for SCAN_V3 (Hector Martin) - wifi: brcmfmac: Mask all IRQs before starting firmware (Hector Martin) - wifi: brcmfmac: Do not set reset vector when signatures are in use (Hector Martin) - wifi: brcmfmac: pcie: Initialize IRQs before firmware boot (Hector Martin) - wifi: brcmfmac: pcie: Access pcie core registers via dedicated window (Hector Martin) - wifi: brcmfmac: Handle watchdog properly in newer cores (Hector Martin) - wifi: brcmfmac: chip: ca7: Only disable D11 cores; handle an arbitrary number (Hector Martin) - wifi: brcmfmac: Increase bandlist size (Hector Martin) - wifi: brcmfmac: msgbuf: Increase RX ring sizes to 2048 (Hector Martin) - wifi: brcmfmac: Add support for firmware signatures (Hector Martin) - wifi: brcmfmac: Add support for SYSMEM corerev >= 12 & fix < 12 (Hector Martin) - wifi: brcmfmac: Do not service msgbuf IRQs until ready in MSI mode (Hector Martin) - wifi: brcmfmac: Shut up p2p unknown frame error (Hector Martin) - wifi: brcmfmac: Support exchanging power mailbox messages via commonring (Hector Martin) - wifi: brcmfmac: Implement the H2D/D2H mailbox data commonring messages (Hector Martin) - wifi: brcmfmac: Add a new bus op for D2H mailbox message handling (Hector Martin) - wifi: brcmfmac: Add newer msgbuf packet types up to 0x2e (Hector Martin) - wifi: brcmfmac: Support v6+ flags and set host_cap properly (Hector Martin) - wifi: brcmfmac: Fix logic for deciding which doorbell registers to use (Hector Martin) - wifi: brcmfmac: Handle PCIe MSI properly (Hector Martin) - wifi: brcmfmac: Add missing shared area defines to pcie.c (Hector Martin) - fixup! ASoC: macaudio: Sense improvements (Janne Grunau) - fixup! ASoC: macaudio: Sense improvements (Janne Grunau) - fixup! ASoC: macaudio: Sense improvements (Janne Grunau) - fixup! ASoC: apple: Add macaudio machine driver (Janne Grunau) - soc: apple: rtkit: Add tracekit endpoint. (Sasha Finkelstein) - soc: apple: rtkit: Add apple_rtkit_has_endpoint() (Sasha Finkelstein) - DO NOT MERGE: dmaengine: apple-admac: Add temporary aop-admac compatible (Sasha Finkelstein) - READ COMMIT MESSAGE! macaudio: Enable second round of models (Hector Martin) - READ COMMIT MESSAGE! macaudio: Enable first round of models (Hector Martin) - ALSA: Support nonatomic dmaengine PCMs (Martin Povišer) - HACK: ALSA: Export 'snd_pcm_known_rates' (Martin Povišer) - fixup! dmaengine: apple-admac: Add Apple ADMAC driver (Martin Povišer) - macaudio: Fix missing kconfig requirement (Sasha Finkelstein) - ASoC: apple: mca: More delay (Hector Martin) - ASoC: apple: mca: Add more delay after configuring clock (Hector Martin) - macaudio: Disable j313 and j274 (Hector Martin) - ASoC: apple: mca: Add delay after configuring clock (Hector Martin) - macaudio: Avoid matches against cs42l84's constrols (Janne Grunau) - macaudio: Fix CHECK return condition checking (Hector Martin) - macaudio: Sync all gains with macOS (Hector Martin) - macaudio: Turn please_blow_up_my_speakers into an int (Hector Martin) - macaudio: Change device ID form Jxxx to AppleJxxx (Hector Martin) - macaudio: Set the card name explicitly (Hector Martin) - ASoC: tas2770: Set the SDOUT polarity correctly (Hector Martin) - macaudio: Officially enable j313 speakers (Hector Martin) - macaudio: Skip speaker sense PCM if no sense or no speakers (Hector Martin) - macaudio: Remove -3dB safety pad from j313 (Hector Martin) - ASoC: tas2770: Support setting the PDM TX slot (Hector Martin) - ASoC: tas2770: Add zero-fill and pull-down controls (Hector Martin) - ASoC: tas2770: Power cycle amp on ISENSE/VSENSE change (Hector Martin) - ASoC: tas2770: Add SDZ regulator (Hector Martin) - macaudio: Rework platform config & add all remaining platforms (Hector Martin) - ASoC: tas2764: Enable some Apple quirks by default (Hector Martin) - ASoC: tas2764: Wait for ramp-down after shutdown (Hector Martin) - ALSA: dmaengine: Always terminate DMA when a PCM is closed (Hector Martin) - ASoC: apple: mca: Increase reset timeout (Hector Martin) - ASoC: tas2764: Mark SW_RESET as volatile (Hector Martin) - ASoC: tas2764: Add reg defaults for TAS2764_INT_CLK_CFG (Hector Martin) - macaudio: Use an explicit mutex for the speaker volume lock (Hector Martin) - ASoC: tas2764: Add SDZ regulator (Hector Martin) - ASoC: tas2764: Power up/down amp on mute ops (Hector Martin) - ASoC: tas2764: Enable main IRQs (Hector Martin) - macaudio: Disable debug (Hector Martin) - macaudio: Use the same volume limit for all amps (Hector Martin) - macaudio: Initialize speaker lock properly (Hector Martin) - macaudio: Enable VSENSE switches (Hector Martin) - macaudio: Allow DT enabled speakers and gate them off in the driver (Hector Martin) - ASoC: apple: mca: Do not mark clocks in use for non-providers (Hector Martin) - macaudio: Add a getter for the interlock (Hector Martin) - alsa: pcm: Remove the qos request only if active (Hector Martin) - macaudio: speaker volume safety interlocks (Hector Martin) - ASoC: ops: Export snd_soc_control_matches() (Hector Martin) - ASoC: macaudio: Sense improvements (Hector Martin) - ASoC: macaudio: Fix PD link double-frees? (Hector Martin) - ASoC: macaudio: Do not disable ISENSE/VSENSE switches on j314 (Martin Povišer) - ASoC: tas2764: Add optional 'Apple quirks' (Martin Povišer) - ASoC: macaudio: Add 'Speakers Up Indicator' control (Martin Povišer) - ASoC: macaudio: Remove stale 'speaker_nchans' fields (Martin Povišer) - ASoC: tas2764: Crop SDOUT zero-out mask based on BCLK ratio (Martin Povišer) - ASoC: tas2764: Export 'die_temp' to sysfs (Martin Povišer) - ASoC: tas2770: Export 'die_temp' to sysfs (Martin Povišer) - ASoC: tas2764: Raise regmap range maximum (Martin Povišer) - WIP: ASoC: tas2764: Apply unknown Apple quirk (Martin Povišer) - ASoC: tas2764: Configure zeroing of SDOUT slots (Martin Povišer) - ASoC: apple: mca: Support capture on multiples BEs (Martin Povišer) - ASoC: macaudio: Tune constraining of FEs, add BCLK (Martin Povišer) - NOT UPSTREAMABLE: ASoC: tas2764: Redo I/V sense logic (Martin Povišer) - ASoC: tas2764: Reinit cache on part reset (Martin Povišer) - ASoC: tas2770: Fix and redo I/V sense TDM slot setting logic (Martin Povišer) - ASoC: tas2770: Factor out set_ivsense_slots (Martin Povišer) - ASoC: macaudio: Do not constrain sense PCM (Martin Povišer) - ASoC: macaudio: Tweak "no audio route" message (Martin Povišer) - ASoC: macaudio: Start speaker sense capture support (Martin Povišer) - ASoC: apple: mca: Fix SYNCGEN enable on FE clock consumers (Martin Povišer) - ASoC: apple: mca: Support FEs being clock consumers (Martin Povišer) - ASoC: apple: mca: Factor out mca_be_get_fe (Martin Povišer) - ASoC: apple: mca: Separate data & clock port setup (Martin Povišer) - ASoC: macaudio: Tune DT parsing error messages (Martin Povišer) - ASoC: macaudio: Condition selecting NCO driver on COMMON_CLK (Martin Povišer) - ALSA: control: Add kcontrol callbacks for lock/unlock (Hector Martin) - ASoC: macaudio: alias j415 kcontrols to j314 (James Calligeros) - ASoC: apple: mca: Move clock shutdown to be shutdown (Hector Martin) - ASoC: cs42l42: Set a faster digital ramp-up rate (Hector Martin) - ASoC: macaudio: constrain frontend channel counts (James Calligeros) - ASoC: macaudio: Add initial j313 fixup_controls (Martin Povišer) - ASoC: macaudio: Improve message on opening of unrouted PCM devices (Martin Povišer) - ASoC: apple: mca: Constrain channels according to TDM mask (Martin Povišer) - ASoC: macaudio: Alias f413 fixups to j314 (Hector Martin) - ASoC: macaudio: Gate off experimental platforms (Hector Martin) - ASoC: macaudio: s/void_warranty/please_blow_up_my_speakers/ (Hector Martin) - ASoC: macaudio: s/Freq/Frequency/ in TAS2764 control (Martin Povišer) - ASoC: macaudio: Drop the 'inverse jack' speaker stuff (Martin Povišer) - ASoC: macaudio: Rename ALSA driver to simple 'macaudio' (Martin Povišer) - ASoC: macaudio: Add j493 fixup_controls (Martin Povišer) - ASoC: macaudio: Add j375 fixup_controls (Martin Povišer) - ASoC: dapm: Export new 'graph.dot' file in debugfs (Martin Povišer) - ASoC: macaudio: Fix headset routes (Martin Povišer) - ASoC: cs42l42: Do not advertise sample bit symmetry (Martin Povišer) - ASoC: cs42l42: Fix typo (Martin Povišer) - ASoC: apple: Add macaudio machine driver (Martin Povišer) - dt-bindings: sound: Add Apple Macs sound peripherals (Martin Povišer) - ASoC: card: Let 'fixup_controls' return errors (Martin Povišer) - ASoC: ops: Introduce 'soc_set_enum_kctl' (Martin Povišer) - ASoC: ops: Introduce 'snd_soc_deactivate_kctl' (Martin Povišer) - ASoC: ops: Accept patterns in snd_soc_limit_volume (Martin Povišer) - ASoC: ops: Enforce platform maximum on initial value (Martin Povišer) - ASoC: ops: Move guts out of snd_soc_limit_volume (Martin Povišer) - ASoC: tas2764: Add control concerning overcurrent events (Martin Povišer) - ASoC: tas2764: Extend driver to SN012776 (Martin Povišer) - Revert "ASoC: ops: Don't modify the driver's plaform_max when reading state" (Martin Povišer) - apple-nvme: Support coprocessors left idle (Hector Martin) - apple-nvme: defer cache flushes by a specified amount (Jens Axboe) - usb: dwc3: core: Allow phy suspend during init for role_switch_reset_quirk (Janne Grunau) - usb: dwc3: apple: Do not use host-vbus-glitches workaround (Janne Grunau) - usb: dwc3: Add support for Apple DWC3 (Sven Peter) - dt-bindings: usb: Add Apple dwc3 bindings (Sven Peter) - mmc: pci: gl9755: Quirk UHS-2 for Apple GL9755 (Janne Grunau) - mmc: sdhci-uhs2: Add quirk for devices with broken UHS-2 (Janne Grunau) - mmc: core: Skip SD UHS-II enumeration on missing UHS2 cap (Janne Grunau) - of: Workaround missing '#{address,size}-cells' properties [drop v6.13 + 2] (Janne Grunau) - Increase MAX_LOCKDEP_CHAIN_HLOCKS (Asahi Lina) - arm64: Increase kernel stack size to 32K (Asahi Lina) - drm/simpledrm: Set DMA and coherency mask (Janne Grunau) - HACK: Lol libwebrtc (Hector Martin) - soc: apple: apple-pmgr-pwrstate: Mark on-at-boot PDs as wakeup (Hector Martin) - tty: serial: samsung_tty: Mark as wakeup_path on no_console_suspend (Hector Martin) - soc: apple: apple-pmgr-pwrstate: Mark on-at-boot PDs as DEFER_OFF (Hector Martin) - PM: domains: Add a flag to defer power-off until all consumers probe (Hector Martin) - driver core: fw_devlink: Add fw_devlink_count_absent_consumers() (Hector Martin) - i2c: pasemi: Log bus reset causes (Hector Martin) - i2c: pasemi: Enable the unjam machine (Hector Martin) - usb: typec: tipd: Be more verbose about errors (Hector Martin) - i2c: pasemi: Improve timeout handling and error recovery (Hector Martin) - firmware_loader: Add /lib/firmware/vendor path (Hector Martin) - PCI: apple: Add depends on PAGE_SIZE_16KB (Janne Grunau) - mmc: sdhci-pci: Support setting CD debounce delay (Hector Martin) - mmc: sdhci-pci: Support external CD GPIO on all OF systems (Hector Martin) - of: Demote "Bad cell count" to debug message (Hector Martin) - tty: serial: samsung_tty: Support runtime PM (Hector Martin) - arm64: Enable IMP DEF PMUv3 traps on Apple M* (Oliver Upton) - KVM: arm64: Provide 1 event counter on IMPDEF hardware (Oliver Upton) - drivers/perf: apple_m1: Provide helper for mapping PMUv3 events (Oliver Upton) - KVM: arm64: Remap PMUv3 events onto hardware (Oliver Upton) - KVM: arm64: Advertise PMUv3 if IMPDEF traps are present (Oliver Upton) - KVM: arm64: Compute synthetic sysreg ESR for Apple PMUv3 traps (Oliver Upton) - KVM: arm64: Move PMUVer filtering into KVM code (Oliver Upton) - KVM: arm64: Use guard() to cleanup usage of arm_pmus_lock (Oliver Upton) - KVM: arm64: Drop kvm_arm_pmu_available static key (Oliver Upton) - KVM: arm64: Use a cpucap to determine if system supports FEAT_PMUv3 (Oliver Upton) - KVM: arm64: Always support SW_INCR PMU event (Oliver Upton) - KVM: arm64: Compute PMCEID from arm_pmu's event bitmaps (Oliver Upton) - drivers/perf: apple_m1: Support host/guest event filtering (Oliver Upton) - drivers/perf: apple_m1: Refactor event select/filter configuration (Oliver Upton) - iommu/of: Free fwspec on probe deferrel (Janne Grunau) - iommu: apple-dart: Check for fwspec in the device probe path (Hector Martin) - iommu: apple-dart: Power on device when handling IRQs (Asahi Lina) - iommu: apple-dart: Allow mismatched bypass support (Hector Martin) - iommu: apple-dart: Increase MAX_DARTS_PER_DEVICE to 3 (Hector Martin) - iommu: apple-dart: Support specifying the DMA aperture in the DT (Hector Martin) - iommu: apple-dart: Add 4-level page table support (Hector Martin) - iommu: apple-dart: Make the hw register fields u32s (Hector Martin) - iommu: apple-dart: Clear stream error indicator bits for T8110 DARTs (Hector Martin) - iommu: io-pgtable: Add 4-level page table support (Hector Martin) - iommu: apple-dart: Enable runtime PM (Hector Martin) - iommu: apple-dart: Link to consumers with blanket RPM_ACTIVE (Martin Povišer) - iommu: apple-dart: Install IOMMU_RESV_TRANSLATED mappings (Janne Grunau) - iommu/dart: Assert !locked when reconfiguring (Alyssa Rosenzweig) - iommu/dart: Reject identity domain for locked DARTs (Alyssa Rosenzweig) - iommu/dart: Set DMA domain for locked DARTs (Alyssa Rosenzweig) - iommu: apple-dart: Don't attempt to reset/restore locked DARTs (Hector Martin) - iommu/dart: Allow locked DARTs to probe (Alyssa Rosenzweig) - iommu/dart: Track if the DART is locked (Alyssa Rosenzweig) - iommu: Parse translated reserved regions (Janne Grunau) - iommu: Add IOMMU_RESV_TRANSLATED for non 1:1 mapped reserved regions (Janne Grunau) - irqchip/apple-aic: Add support for AICv3 (Janne Grunau) - soc: apple: rtkit: Pass 0 as size for a NULL crashlog buffer (Janne Grunau) - soc: apple: rtkit: Use scope-based cleanup in apple_rtkit_crashlog_rx() (Janne Grunau) - soc: apple: rtkit: Fix use-after-free in apple_rtkit_crashlog_rx() (Harshit Mogalapalli) - cpuidle: apple: Do not load on unsupported Apple platforms (Janne Grunau) - cpuidle: apple: Add Apple SoC cpuidle driver (Hector Martin) - soc: apple: pmgr: Add externally-clocked property (Hector Martin) - soc: apple: pmgr: Add force-disable/force-reset (Asahi Lina) - dt-bindings: power: apple,pmgr-pwrstate: Add force-{disable,reset} (Asahi Lina) - soc: apple: Add driver for Apple PMGR misc controls (Hector Martin) - soc: apple: rtkit: Cut syslog messages after the first '\0' (Janne Grunau) - soc: apple: rtkit: Use high prio work queue (Janne Grunau) - soc: apple: rtkit: Add devm_apple_rtkit_free() (Janne Grunau) - soc: apple: rtkit: Implement OSLog buffers properly (Hector Martin) - soc: apple: rtkit: Add APPLE_RTKIT_PWR_STATE_INIT (Janne Grunau) - soc: apple: rtkit: Log failed buffer requests (Asahi Lina) - soc: apple: rtkit: Log failure to send messages (Asahi Lina) - soc: apple: rtkit: Check for failure to send mgmt messages & log (Asahi Lina) - MAINTAINERS: Add apple-spi driver & binding files (Hector Martin) - MAINTAINERS: Add Apple dwc3 bindings to ARM/APPLE (Hector Martin) - drm: Select DRM_KMS_HELPER from DRM_DEBUG_DP_MST_TOPOLOGY_REFS (Janne Grunau) - arm64: dts: apple: t8112-j493: Mark missing beamforming (Janne Grunau) - arm64: dts: apple: t8103-j45x: Mark missing beamforming (Janne Grunau) - arm64: dts: apple: t8103-j293: Mark missing beamforming (Janne Grunau) - arm64: dts: apple: t8112-j493: Enable AOP (Janne Grunau) - arm64: dts: apple: t8112-j415: Enable AOP (Janne Grunau) - arm64: dts: apple: t8112-j413: Enable AOP (Janne Grunau) - arm64: dts: apple: t8103-j45x: Enable AOP (Janne Grunau) - arm64: dts: apple: t8103-j313: Enable AOP (Janne Grunau) - arm64: dts: apple: t8103-j293: Enable AOP (Janne Grunau) - arm64: dts: apple: t600x-j314-j316: Enable AOP (Janne Grunau) - arm64: dts: apple: Remove no-map from remaining agx regions (Asahi Lina) - arm64: dts: apple: Remove no-map from pagetables region (Asahi Lina) - fixup! arm64: dts: apple: t602x: Add t6020 dispext device nodes (Janne Grunau) - fixup! arm64: dts: apple: t602x: Add t6020 dispext device nodes (Janne Grunau) - fixup! arm64: dts: apple: t8112: Add dcpext/dispext0 nodes (Janne Grunau) - fixup! arm64: dts: apple: t600x: Add t6000 dispext device nodes (Janne Grunau) - fixup! arm64: dts: apple: t600x: Add t6000 dispext device nodes (Janne Grunau) - fixup! arm64: dts: apple: t8103: Add dcpext/dispext0 nodes (Janne Grunau) - fixup! arm64: dts: apple: Add initial t602x device trees (Janne Grunau) - fixup! arm64: dts: apple: t8112: Add dcp/disp0 nodes (Janne Grunau) - fixup! arch: arm64: apple: t600x: Add display controller related device tree nodes (Janne Grunau) - fixup! arch: arm64: apple: Add display controller related device tree nodes (Janne Grunau) - arm64: dts: apple: Add AOP audio identifiers (Sasha Finkelstein) - arm64: dts: apple: Add SEP device tree nodes (Sasha Finkelstein) - arm64: dts: apple: Add AOP and subdevices (Sasha Finkelstein) - DO NOT MERGE: arm64: dts: apple: t8103: Add cs-gpios to touchbar node (Janne Grunau) - arm64: dts: apple: j474s: correct case of Mac mini (Jonathan Gray) - arm64: dts: apple: t602x-j4xx: Add SMC hwmon sensors (Janne Grunau) - arm64: dts: apple: t600x-j3xx: Add SMC hwmon sensors (Janne Grunau) - arm64: dts: apple: t8112: Add SMC hwmon sensors (Janne Grunau) - arm64: dts: apple: t8103: Add SMC hwmon sensors (Janne Grunau) - arm64: dts: apple: add common hwmon keys and fans (James Calligeros) - arm64: apple: t8112-j473: Enable sio explicitly (Janne Grunau) - arm64: apple: t8103-j274: Enable sio explicitly (Janne Grunau) - arm64: apple: t60x0/t60x1: Enable sio explicitly (Janne Grunau) - arm64: apple: t60xx: Enable DP/HMI audio nodes on all devices (Janne Grunau) - arm64: apple: t602x: Add sio and dpaudio device nodes (Janne Grunau) - arm64: apple: t600x: Add sio and dpaudio device nodes (Janne Grunau) - arm64: apple: t600x: Move dart_sio* to dieX (Janne Grunau) - arm64: apple: t8112: Add SIO, DPA nodes; hook up to DCP (Janne Grunau) - arm64: apple: t8103: Add SIO, DPA nodes; hook up to DCP (Martin Povišer) - arm64: apple: t602x: pmgr: SIO: Add audio, spi and uart power-domains (Janne Grunau) - arm64: apple: t600x: pmgr: SIO: Add audio, spi and uart power-domains (Janne Grunau) - arm64: apple: t8112-pmgr: SIO: Add audio, spi and uart power-domains (Janne Grunau) - arm64: apple: t8103-pmgr: SIO: Add audio, spi and uart power-domains (Martin Povišer) - arm64: dts: apple: t8112-j473: Use dcpext for HDMI out (Janne Grunau) - arm64: dts: apple: j474s/j475c: Use dcpext0 for HDMI out (Janne Grunau) - arm64: dts: apple: Fill device node for dp2hdmi on Macbook Pros (Janne Grunau) - arm64: dts: apple: t6022-{j180,j475}: Enable dcpext0/dptx-phy/dp2hdmi (Janne Grunau) - arm64: dts: apple: t6020-j474,t6021-j475: Enable dcp/dptx-phy/dp2hdmi (Janne Grunau) - arm64: dts: apple: t8112-j473: Enable dcp/dptx-phy/dp2hdmi (Janne Grunau) - arm64: dts: apple: t602x: Add device nodes for atc DP crossbar (Janne Grunau) - arm64: dts: apple: t600x: Add device nodes for atc DP crossbar (Janne Grunau) - arm64: dts: apple: t602x: Add lpdptx-phy node (Janne Grunau) - arm64: dts: apple: t8112: Add dptx-phy node (Janne Grunau) - arm64: dts: apple: t602x: Add t6020 dispext device nodes (Janne Grunau) - arm64: dts: apple: t600x: Add t6000 dispext device nodes (Janne Grunau) - arm64: dts: apple: t8112: Add dcpext/dispext0 nodes (Janne Grunau) - arm64: dts: apple: t8103: Add dcpext/dispext0 nodes (Janne Grunau) - arm64: dts: apple: t602x: Add "apple,min-state" to ps_dispextN_cpu0 (Janne Grunau) - arm64: dts: apple: t600x: Add "apple,min-state" to ps_dispextN_cpu0 (Janne Grunau) - arm64: dts: apple: t8112: Switch to apple,dma-range (Janne Grunau) - arm64: dts: apple: t8103: Switch to apple,dma-range (Janne Grunau) - arm64: dts: apple: t600x: Switch to apple,dma-range (Janne Grunau) - arm64: dts: apple: Disable ps_isp_sys unless it is used (Janne Grunau) - arm64: dts: apple: add opp-microwatt to t8103/t600x (James Calligeros) - arm64: dts: apple: j313: Model SDZ GPIO as a regulator (Hector Martin) - arm64: dts: apple: j293: Model SDZ GPIO as a regulator (Hector Martin) - arm64: dts: apple: describe shared SDZ GPIO for tas2764 (James Calligeros) - arm64: dts: apple: j493: Enable speakers (Hector Martin) - arm64: dts: apple: j313: Enable speakers (Hector Martin) - arm64: dts: apple: j293: Enable speakers (Hector Martin) - arm64: dts: apple: j375 & friends: Enable speakers (Hector Martin) - arm64: dts: apple: t600x-j314-j316: Set sound compatibles per device (Hector Martin) - arm64: dts: apple: j413: Model SDZ GPIO as a regulator (Hector Martin) - arm64: dts: apple: j493: Add missing speaker amp IRQs (Hector Martin) - arm64: dts: apple: j415: Add missing speaker amp IRQs (Hector Martin) - arm64: dts: apple: j413: Add missing speaker amp IRQs (Hector Martin) - arm64: dts: apple: j313: Add missing speaker amp IRQs (Hector Martin) - arm64: dts: apple: j293: Add missing speaker amp IRQs (Hector Martin) - arm64: dts: apple: j375: Add missing speaker amp IRQs (Hector Martin) - arm64: dts: apple: j415: Enable speakers (Hector Martin) - arm64: dts: apple: j413: Enable speakers (Hector Martin) - arm64: dts: apple: j314/j316: Enable speakers (Hector Martin) - arm64: dts: apple: t8103-j313: Add I/VMON slots to amps (Hector Martin) - arm64: dts: apple: t8103-j293: Add I/VMON slots to amps (Hector Martin) - arm64: dts: apple: t8112-j493: Add I/VMON slots to amps (Hector Martin) - arm64: dts: apple: t8112-j473: Add I/VMON slots to amp (Hector Martin) - arm64: dts: apple: t8112-j415: Add I/VMON slots to amps (Hector Martin) - arm64: dts: apple: t8112-j413: Add I/VMON slots to amps (Hector Martin) - arm64: dts: apple: t600x-j180d: Add I/VMON slots to amps (Hector Martin) - arm64: dts: apple: t600x-j375: Add I/VMON slots to amp (Hector Martin) - arm64: dts: apple: t8112: Mark MCA power states as externally-clocked (Hector Martin) - arm64: dts: apple: t8103: Mark MCA power states as externally-clocked (Hector Martin) - arm64: dts: apple: t602x: Mark MCA power states as externally-clocked (Hector Martin) - arm64: dts: apple: t600x: Mark MCA power states as externally-clocked (Hector Martin) - arm64: dts: apple: t600x-j314-j316: Zero out unused speaker sense slots (Martin Povišer) - arm64: dts: apple: t600x-j314-j316: Add speaker I/V sense slots (Martin Povišer) - arm64: dts: apple: t8103-j274: Add speaker I/V sense slots (Martin Povišer) - arm64: dts: apple: imx558: Add downscaled resolution presets (Hector Martin) - arm64: dts: apple: imx248: Add scaled and cropped presets (Janne Grunau) - arm64: dts: ISP platform configs (Asahi Lina) - arm64: dts: apple: t602x: Add ISP nodes (Asahi Lina) - arm64: dts: apple: t8112: Add ISP nodes (Hector Martin) - arm64: dts: apple: t6000: Add ISP nodes (Eileen Yoon) - arm64: dts: apple: t8103: Add ISP nodes (Eileen Yoon) - arm64: dts: apple: t8112: Add nvram alias (Hector Martin) - arm64: dts: apple: t8103: Add nvram alias (Hector Martin) - arm64: dts: apple: t6022-j180.dtsi: Add spi nor flash and nvram partition (Janne Grunau) - arm64: dts: apple: t600x-j375.dtsi: Add spi nor flash and nvram partition (Janne Grunau) - arm64: dts: apple: t8112: add opp-microwatt props to avalanche/blizzard (James Calligeros) - arm64: dts: apple: t6020x: Mark dptx_phy_ps only on laptops always-on (Janne Grunau) - arm64: dts: apple: t8112-j473: Add dptx-phy power-domain (Janne Grunau) - arm64: dts: apple: t602x: Add initial Mac Studio (2023) device trees (Janne Grunau) - arm64: dts: apple: t6020-j474s: Disable dcp until lpdpphy is supported (Janne Grunau) - arm64: dts: apple: t6022: Disable dcp thouroughly (Janne Grunau) - arm64: dts: apple: Share USB-C port node on t6022 devices (Janne Grunau) - arm64: dts: apple: t8112-j473: Set GPU base pstate (Asahi Lina) - arm64: dts: apple: Add devicetree for Macbook Air (15-inch, M2, 2023) (Janne Grunau) - arm64: dts: apple: t8112: Add touchbar digitizer node (Janne Grunau) - arm64: dts: apple: t8103: Add touchbar bindings (Sasha Finkelstein) - arm64: dts: apple: Add touchbar display nodes for t8112-j493 (Janne Grunau) - arm64: dts: apple: t8103: Add touchbar screen bindings (Sasha Finkelstein) - arm64: dts: apple: t6022: Add APCIE-GE nodes (Hector Martin) - arm64: dts: apple: Add j180d (Mac Pro 2023) device tree (Hector Martin) - arm64: dts: apple: Add initial t6022 support (Hector Martin) - arm64: dts: apple: t600x-j375.dtsi: Add missing etherhet0 alias (Hector Martin) - arm64: dts: apple: Add T602x GPU node (Asahi Lina) - arm64: dts: apple: t8112: Enable turbo CPU p-states (Hector Martin) - arm64: dts: apple: t8103: Enable turbo CPU p-states (Hector Martin) - arm64: dts: apple: t600x: Enable turbo CPU p-states (Hector Martin) - arm64: dts: apple: Make ps_msg always-on (Hector Martin) - arm64: dts: apple: t600x: Remove obsolete comment in ans2 power domain (Hector Martin) - arm64: dts: apple: Add pmgr-misc nodes to t60xx (Hector Martin) - DO NOT SUBMIT: arm64: dts: apple: t6020-j474s: Add unused PCIe port01 (Janne Grunau) - arm64: dts: apple: Add identity dma-ranges mapping (Hector Martin) - arm64: dts: apple: Add MTP nodes to t6020x (Hector Martin) - arm64: dts: apple: Add initial t602x device trees (Hector Martin) - arm64: dts: apple: Fix t600x mca IRQs (Hector Martin) - arm64: dts: apple: Add keyboard alias & layout props for t8112 laptops (Hector Martin) - arm64: dts: apple: j314/j316: Disable ATC3_USB_AON power domain (Hector Martin) - arm64: dts: apple: t8112: Add "ps_disp0_cpu0" as resets for dcp (Janne Grunau) - arm64: dts: apple: t8103: Add "ps_disp0_cpu0" as resets for dcp (Janne Grunau) - arm64: dts: apple: t600x: Add "ps_disp0_cpu0" as resets for dcp (Janne Grunau) - arm64: dts: apple: t8103: Add missing ps_pmp dependency to ps_gfx (Janne Grunau) - arm64: dts: apple: t8112: Add DCP power domain to missing devices (Hector Martin) - arm64: dts: apple: t8103: Add DCP power domain to missing devices (Hector Martin) - arm64: dts: apple: t600x: Add DCP power domain to missing devices (Hector Martin) - arm64: dts: apple: Add GPU firmware versions to t8113/t600x (Asahi Lina) - arm64: dts: apple: Add GPU nodes to T8112 (Asahi Lina) - arm64: dts: apple: Add no-map to GPU reserved-memory nodes (Asahi Lina) - arm64: dts: t8103: Add GPU leak coefficients (Asahi Lina) - arm64: dts: Add t600x GPU nodes (Asahi Lina) - arm64: dts: Add power data for t8103 (Asahi Lina) - arm64: dts: Add GPU performance data to t8103.dts (Asahi Lina) - arm64: dts: apple: t8103*: Add GPU nodes (Asahi Lina) - scripts/dtc: Add support for floating-point literals (Asahi Lina) - arm64: dts: apple: t8112: Add dcp/disp0 nodes (Janne Grunau) - arm64: dts: apple: t8112: Add ATCPHY nodes (Janne Grunau) - arm64: dts: apple: t8112: Add eFuses node (Janne Grunau) - arch: arm64: apple: Add dcp panel node for t600x based laptops (Janne Grunau) - arch: arm64: apple: Add dcp panel node for t8103 based laptops and imacs (Janne Grunau) - arch: arm64: dts: apple: t600x: Add ATCPHY nodes (R) - arch: arm64: dts: apple: t6000: Add eFuses node (R) - arm64: dts: apple: t8103: Add ATCPHY node (Sven Peter) - arm64: dts: apple: t8103: Add eFuses node (Sven Peter) - arch: arm64: apple: t600x: Add connector type property for DCP* (Janne Grunau) - arch: arm64: apple: t8103: Add connector type property for DCP* (Janne Grunau) - arch: arm64: apple: t600x: Add display controller related device tree nodes (Janne Grunau) - arch: arm64: apple: Add display controller related device tree nodes (Hector Martin) - arch: arm64: apple: t600x: Mark USB and PCIe as "dma-coherent" (Janne Grunau) - arch: arm64: apple: Add missing power state deps for display (Janne Grunau) - arm64: dts: apple: t6001-j375c: Add USB3 hub GPIO initialization (Hector Martin) - arm64: dts: apple: Drop 'integrated audio' from sound models (Martin Povišer) - arm64: dts: apple: t600x-jxxx: Put in audio nodes (Martin Povišer) - arm64: dts: apple: t8103*: Put in audio nodes (Martin Povišer) - arm64: dts: apple: t600x: Add bluetooth device trees (Hector Martin) - arm64: dts: apple: Add PCI power enable GPIOs (Hector Martin) - arm64: dts: apple: Add WiFi module and antenna properties (Hector Martin) - arm64: dts: apple: t600x: Add dwc3 nodes (Janne Grunau) - arm64: dts: apple: j31[46]: Add keyboard nodes (Janne Grunau) - arm64: dts: apple: Add PMU NVMEM and SMC RTC/reboot nodes (Hector Martin) - arm64: dts: apple: Add SMC node to t600x devicetrees (Hector Martin) - arm64: dts: apple: Keep PCIe power domain on (Hector Martin) - arm64: dts: apple: Mark ATC USB AON domains as always-on (Hector Martin) - arm64: dts: apple: Add PMU NVMEM and SMC RTC/reboot nodes (Hector Martin) - arm64: dts: apple: Add SMC node to t8103/t6001 devicetrees (Hector Martin) - arm64: dts: apple: Add PCI power enable GPIOs (Hector Martin) - arm64: dts: apple: t8103: Add spi3 keyboard node (Janne Grunau) - arm64: dts: apple: t8103: Add dwc3 nodes (Hector Martin) - arm64: dts: apple: t8112: Add mtp device nodes for j413/j493 (Janne Grunau) - arm64: dts: apple: t8112: Add dwc3 nodes (Janne Grunau) - arm64: dts: apple: t8112*: Put in audio nodes (Martin Povišer) - arm64: dts: apple: t8112: Add SMC node to devicetree (Hector Martin) - arm64: dts: apple: t8112: Add PMU NVMEM and SMC RTC/reboot nodes (Hector Martin) - arm64: dts: apple: t8112: Add wlan/bt PCIe device nodes (Janne Grunau) - arm64: dts: apple: t8112: Remove always-on from the PMP node (Hector Martin) - arm64: dts: apple: Add SPI NOR nvram partition to all devices (Janne Grunau) - arm64: dts: apple: t600x: Add spi controller nodes (Janne Grunau) - arm64: dts: apple: t8112: Add spi controller nodes (Janne Grunau) - arm64: dts: apple: t8103: Add spi controller nodes (Janne Grunau) - arm64: dts: apple: t8103: Fix spi4 power domain sort order (Hector Martin) - soc: apple: rtkit: Pass the crashlog to the crashed() callback (Asahi Lina) - powerpc64/ftrace: fix module loading without patchable function entries (Anthony Iliopoulos)- Add to BugsFixed (Justin M. Forbes) - EDAC/igen6: Fix the flood of invalid error reports (Qiuxu Zhuo) - Linux v6.13.8- Set CONFIG_FW_CACHE=y for rhel to avoid config mismatch issues (Augusto Caringi) - media: ov08x40: Extend sleep after reset to 5 ms (Hans de Goede) - media: ov08x40: Log chip ID when identifying the chip (Hans de Goede) - media: ov08x40: Fix value of reset GPIO when requesting it (Hans de Goede) - ASoC: rt712-sdca: Add FU05 playback switch control (Shuming Fan) [2350689] - Linux v6.13.7- Fix up some debug module loading issues due to BTF mismatch (Justin M. Forbes) - Linux v6.13.6- fuse: revert back to __readahead_folio() for readahead (Joanne Koong) - Linux v6.13.5- Config update for 6.13.4 stable (Justin M. Forbes) - mei: vsc: Use "wakeuphostint" when getting the host wakeup GPIO (Hans de Goede) - Fix up mismatch of CONFIG_CPUFREQ_DT_PLATDEV for automotive (Justin M. Forbes) - Linux v6.13.4- CONFIG_CPUFREQ_DT_PLATDEV is bool now (Justin M. Forbes) - efi,lockdown: fix kernel lockdown on Secure Boot (Ondrej Mosnacek) {CVE-2025-1272} - Config update for 6.13.2 (Justin M. Forbes) - Linux v6.13.3- Fix up configs for CONFIG_USB_ONBOARD_DEV_USB5744 (Justin M. Forbes) - fedora: enable USB device USB5744 (Peter Robinson) - Linux v6.13.2- media: ov08x40: Don't log ov08x40_check_hwcfg() errors twice (Hans de Goede) - media: ov08x40: Add missing '\n' to ov08x40_check_hwcfg() error messages (Hans de Goede) - media: ov08x40: Add missing ov08x40_identify_module() call on stream-start (Hans de Goede) - media: ov08x40: Improve ov08x40_[read|write]_reg() error returns (Hans de Goede) - media: ov08x40: Improve ov08x40_identify_module() error logging (Hans de Goede) - media: ov08x40: Move ov08x40_identify_module() function up (Hans de Goede) - media: ov08x40: Get clock on ACPI platforms too (Hans de Goede) - media: ov08x40: Get reset GPIO and regulators on ACPI platforms too (Hans de Goede) - media: ov08x40: Move fwnode_graph_get_next_endpoint() call up (Hans de Goede) - media: ov08x40: Properly turn sensor on/off when runtime-suspended (Hans de Goede) - Turn on drivers for INTEL_THC_HID (Justin M. Forbes) - HID: intel-thc-hid: fix build errors in um mode (Even Xu) - HID: intel-thc-hid: intel-quicki2c: fix potential memory corruption (Even Xu) - HID: intel-thc-hid: intel-thc: Fix error code in thc_i2c_subip_init() (Dan Carpenter) - HID: intel-thc-hid: intel-quicki2c: Add PM implementation (Even Xu) - HID: intel-thc-hid: intel-quicki2c: Complete THC QuickI2C driver (Even Xu) - HID: intel-thc-hid: intel-quicki2c: Add HIDI2C protocol implementation (Even Xu) - HID: intel-thc-hid: intel-quicki2c: Add THC QuickI2C ACPI interfaces (Even Xu) - HID: intel-thc-hid: intel-quicki2c: Add THC QuickI2C driver hid layer (Even Xu) - HID: intel-thc-hid: intel-quicki2c: Add THC QuickI2C driver skeleton (Even Xu) - HID: intel-thc-hid: intel-quickspi: Add PM implementation (Even Xu) - HID: intel-thc-hid: intel-quickspi: Complete THC QuickSPI driver (Xinpeng Sun) - HID: intel-thc-hid: intel-quickspi: Add HIDSPI protocol implementation (Even Xu) - HID: intel-thc-hid: intel-quickspi: Add THC QuickSPI ACPI interfaces (Even Xu) - HID: intel-thc-hid: intel-quickspi: Add THC QuickSPI driver hid layer (Even Xu) - HID: intel-thc-hid: intel-quickspi: Add THC QuickSPI driver skeleton (Xinpeng Sun) - HID: intel-thc-hid: intel-thc: Add THC I2C config interfaces (Even Xu) - HID: intel-thc-hid: intel-thc: Add THC SPI config interfaces (Xinpeng Sun) - HID: intel-thc-hid: intel-thc: Add THC interrupt handler (Xinpeng Sun) - HID: intel-thc-hid: intel-thc: Add THC LTR interfaces (Xinpeng Sun) - HID: intel-thc-hid: intel-thc: Add THC DMA interfaces (Even Xu) - HID: intel-thc-hid: intel-thc: Add APIs for interrupt (Xinpeng Sun) - HID: intel-thc-hid: intel-thc: Add THC PIO operation APIs (Xinpeng Sun) - HID: intel-thc-hid: intel-thc: Add THC registers definition (Xinpeng Sun) - HID: intel-thc-hid: Add basic THC driver skeleton (Xinpeng Sun) - HID: THC: Add documentation (Even Xu) - redhat: fix modules.order target (Scott Weaver) - kernel.spec: update license field (Scott Weaver) - x86/insn_decoder_test: allow longer symbol-names (David Rheinsberg) - Initial setup for stable Fedora releases (Justin M. Forbes) - Turn off CONFIG_ARM_TIMER_SP804 for automotive (Justin M. Forbes) - Set ARM_TIMER_SP804 (Justin M. Forbes) - redhat/configs: enable addtional sa8775 related Kconfigs (Brian Masney) - redhat: Add rustfmt to deps (Peter Robinson) - Linux v6.13.1- redhat/configs: Disable deprecated CONFIG_LCS option on s390 (Mete Durlu) [RHEL-68296] - redhat/configs: make modular/disable NFS support (Dorinda Bassey) - redhat/configs: Disable unsafe queuing disciplines (Dorinda Bassey) - Linux v6.13.0- Linux v6.13.0-0.rc7.fda5e3f28400- Linux v6.13.0-0.rc7.595523945be0- configs: move pending RT configs into rhel/rt/generic (Clark Williams) - Turn on PROVE_RAW_LOCK_NESTING for RHEL debug builds (Justin M. Forbes) - redhat/Makefile: Fix long dist-full-help execution time (Prarit Bhargava) - redhat/self-test: Update data to add HELP_TYPES variable (Prarit Bhargava) - redhat/Makefile: Add new dist-help functionality (Prarit Bhargava) - Makefile: Do not output LOCALVERSION message for help commands (Prarit Bhargava) - Linux v6.13.0-0.rc7.9bffa1ad25b8- Fedora 6.13 configs part 2 (Justin M. Forbes) - Fedora 6.13 configs part 1 (Justin M. Forbes)- redhat/configs: enable CONFIG_VFAT_FS as a module (Dorinda Bassey) - redhat: create 'debug' addon for UKI (Li Tian) - Linux v6.13.0-0.rc7.619f0b6fad52- kernel.spec: Build cpupower on riscv64 (Yanko Kaneti) - Linux v6.13.0-0.rc7.c45323b7560e- Linux v6.13.0-0.rc7- Linux v6.13.0-0.rc6.b62cef9a5c67- Linux v6.13.0-0.rc6.77a903cd8e5a- RHEL: Set correct config option for CRYPTO_HMAC_S390 (Mete Durlu) [RHEL-24137] - redhat/kernel.spec: add iputils to the requires list for selftests-internal (Brian Masney) - Linux v6.13.0-0.rc6.2144da25584e- Linux v6.13.0-0.rc6.eea6e4b4dfb8- redhat/kernel.spec.template: Require kernel-tools-libs in rtla (Tomas Glozar) - redhat: make kernel-debug-uki-virt installable without kernel-debug-core (Vitaly Kuznetsov) - redhat/configs: enable CONFIG_USB_XHCI_PCI_RENESAS on RHEL (Desnes Nunes) [RHEL-72093] - redhat/configs: Re-enable ZRAM backends and unify configuration (Neal Gompa) - Linux v6.13.0-0.rc6.09a0fa92e5b4- Linux v6.13.0-0.rc6.fbfd64d25c7a- Linux v6.13.0-0.rc6- Linux v6.13.0-0.rc5.ab75170520d4- Linux v6.13.0-0.rc5.63676eefb7a0- Linux v6.13.0-0.rc5.0bc21e701a6f- Linux v6.13.0-0.rc5.56e6a3499e14- Linux v6.13.0-0.rc5.ccb98ccef0e5- Linux v6.13.0-0.rc5- Linux v6.13.0-0.rc4.059dd502b263- Linux v6.13.0-0.rc4.fd0584d220fe- Linux v6.13.0-0.rc4.d6ef8b40d075- Linux v6.13.0-0.rc4.9b2ffa6148b1- Linux v6.13.0-0.rc4.f07044dd0df0- Linux v6.13.0-0.rc4- Linux v6.13.0-0.rc3.48f506ad0b68- Linux v6.13.0-0.rc3.499551201b5f- Linux v6.13.0-0.rc3.8faabc041a00- redhat/configs: automotive: disable CONFIG_AIO (Davide Caratti) - Linux v6.13.0-0.rc3.eabcdba3ad40- Linux v6.13.0-0.rc3.aef25be35d23- redhat/configs: Re-enable CONFIG_INFINIBAND_VMWARE_PVRDMA (Vitaly Kuznetsov) - redhat/configs: PREEMPT_NOTIFIERS does not need to be explicitly listed (Michal Schmidt) - redhat/configs: delete all CONFIG_PREEMPT_*BEHAVIOUR (Michal Schmidt) - Linux v6.13.0-0.rc3.f44d154d6e3d- redhat/configs: automotive: disable CONFIG_NET_DROP_MONITOR (Davide Caratti) - Linux v6.13.0-0.rc3- Linux v6.13.0-0.rc2.2d8308bf5b67- Linux v6.13.0-0.rc2.a446e965a188- redhat/configs: Enable the CS42L84 driver on Fedora (Neal Gompa) - Linux v6.13.0-0.rc2.f932fb9b4074- generic: Remove and cleanups from staging 6.13 (Peter Robinson) - redhat: configs: Clean up DVB settings in RHEL (Kate Hsuan) - Move CONFIG_ARCH_TEGRA_241_SOC config/common so that it is enabled for RHEL as well as Fedora. Get rid of uneeded CONFIG_TEGRA241_CMDQV in configs/fedora while we're at it. (Mark Salter) - fedora: arm64: Enable the rockchip HDMI QP support (Peter Robinson) - Linux v6.13.0-0.rc2.231825b2e1ff- crypto: rng - Fix extrng EFAULT handling (Herbert Xu) - redhat: configs: rhel: aarch64: Support NV Jetson MIPI camera (Kate Hsuan) - Linux v6.13.0-0.rc2.f92f4749861b- gitlab-ci: disable clang CI pipelines (Scott Weaver) - redhat/configs: Remove obsolete arch64/64k/CONFIG_FORCE_MAX_ZONEORDER (Waiman Long) - Fix up QCOM_EMAC config for Fedora (Justin M. Forbes) - Linux v6.13.0-0.rc2.7cb1b4663150- redhat/configs: automotive: disable CONFIG_IO_URING (Ian Mullins) - Linux v6.13.0-0.rc2- Linux v6.13.0-0.rc1.7503345ac5f5- Linux v6.13.0-0.rc1.b5f217084ab3- redhat/kernel.spec.template: Link rtla against in-tree libcpupower (Tomas Glozar) - Linux v6.13.0-0.rc1.b8f52214c61a- redhat: configs: enable INTEL_PLR_TPMI for RHEL (David Arcari) - configs: Enable CONFIG_NETKIT for RHEL (Toke Høiland-Jørgensen) - redhat: fix build/install targets in netfilter kselftest (Davide Caratti) - RHEL: disable the btt driver (Jeff Moyer)- Linux v6.13.0-0.rc1.feffde684ac2- redhat/configs: default to PREEMPT_LAZY on x86, riscv (Michal Schmidt) - redhat/configs: New config CONFIG_PREEMPT_LAZY (Michal Schmidt) - Linux v6.13.0-0.rc1.cdd30ebb1b9f- Linux v6.13.0-0.rc1.e70140ba0d2b- Linux v6.13.0-0.rc0.2ba9f676d0a2- Linux v6.13.0-0.rc0.7af08b57bcb9- crypto: sig - Disable signing (Herbert Xu) - Linux v6.13.0-0.rc0.b86545e02e8c- redhat/configs: enable SERIAL_AMBA_PL011 for automotive (Radu Rendec) - c10s: disable tests in CKI pipelines (Michael Hofmann) - redhat: Drop bpftool from kernel spec (Viktor Malik) - Linux v6.13.0-0.rc0.aaf20f870da0- Linux v6.13.0-0.rc0.7eef7e306d3c- Linux v6.13.0-0.rc0.9f16d5e6f220- Better fixes for the fedora mismatch (Justin M. Forbes) - Mismatch fix ups for Fedora (Justin M. Forbes) - Linux v6.13.0-0.rc0.228a1157fb9f- Linux v6.13.0-0.rc0.28eb75e178d3- redhat/configs: Enable Intel Bluetooth PCIE drivers (Bastien Nocera)- One more pending to fix a mismatch (Justin M. Forbes) - redhat: fix RT PREEMPT configs for Fedora and RHEL (Clark Williams) - Pending fixes to avoid mismatch for 6.13 (Justin M. Forbes) - Linux v6.13.0-0.rc0.fcc79e1714e8- Linux v6.13.0-0.rc0.bf9aa14fc523- Reset changelog for 6.13 (Justin M. Forbes)- Reset RHEL_RELEASE for 6.13 (Justin M. Forbes) - redhat: Move perf_dlfilter.h from libperf-devel to perf (Akihiko Odaki) - Consolidate configs to common for 6.12 (Justin M. Forbes) - redhat/configs: cleanup CONFIG_DEV_DAX (David Hildenbrand) - redhat/configs: cleanup CONFIG_TRANSPARENT_HUGEPAGE_MADVISE for Fedora (David Hildenbrand) - redhat/configs: cleanup CONFIG_TRANSPARENT_HUGEPAGE (David Hildenbrand) - redhat/configs: enable CONFIG_TRANSPARENT_HUGEPAGE on s390x in Fedora (David Hildenbrand) - redhat/configs: automotive: Enable j784s4evm am3359 tscadc configs (Joel Slebodnick) - redhat/configs: delete renamed CONFIG_MLX5_EN_MACSEC (Michal Schmidt) - rhel: disable DELL_RBU and cleanup related deps (Peter Robinson) - crypto: rng - Ensure stdrng is tested before user-space starts (Herbert Xu) - gitlab-ci: Add CKI_RETRIGGER_PIPELINE (Tales da Aparecida) - redhat: configs: disable the qla4xxx iSCSI driver (Chris Leech) [RHEL-1242] - Remove duplicated CONFIGs between automotive and RHEL (Julio Faracco) - redhat: update self-test data for addition of automotive (Scott Weaver) - gitlab-ci: enable automotive pipeline (Scott Weaver) - automotive: move pending configs to automotive/generic (Scott Weaver) - redhat/configs: change Renesas eMMC driver and dependencies to built-in (Radu Rendec) - redhat/configs: automotive: Remove automotive specific override CONFIG_OMAP2PLUS_MBOX By removing this automotive-specific override, the configuration will default to the common configuration (CONFIG_OMAP2PLUS_MBOX=m), which enables the driver as a module. (Martin McConnell) - Config enablement of the Renesas R-Car S4 SoC (Radu Rendec) [RHEL-44306] - redhat/configs: automotive: Enable USB_CDNS3_TI for TI platforms (Andrew Halaney) - redhat/configs: automotive: Enable j784s4evm SPI configs (Joel Slebodnick) - redhat/configs: automotive: Enable TPS6594 MFD (Joel Slebodnick) - redhat/configs: automotive: stop overriding CRYPTO_ECDH (Andrew Halaney) - redhat/configs: automotive: Enable PCI_J721E (Andrew Halaney) - redhat/configs: change some TI platform drivers to built-in (Enric Balletbo i Serra) - redhat/configs: automotive: Enable TI j784s4evm display dependencies (Andrew Halaney) - redhat/configs: automotive: match ark configs to cs9 main-automotive (Shawn Doherty) [RHEL-35995] - redhat/configs: automotive: Enable TI's watchdog driver (Andrew Halaney) - redhat/configs: automotive: Enable TI's UFS controller (Andrew Halaney) - redhat/configs: automotive: Enable networking on the J784S4EVM (Andrew Halaney) [RHEL-29245] - Disable unsupported kernel variants for automotive (Don Zickus) - Disable CONFIG_RTW88_22BU (Don Zickus) - redhat: Delete CONFIG_EFI_ZBOOT to use the common CONFIG (Julio Faracco) - redhat: Update automotive SPEC file with new standards (Julio Faracco) - redhat: Disable WERROR for automotive temporarily (Julio Faracco) - redhat: Update spec file with automotive macros (Julio Faracco) - redhat: Add automotive CONFIGs (Julio Faracco) - Fedora configs for 6.12 (Justin M. Forbes) - redhat/configs: Add CONFIG_CRYPTO_HMAC_S390 config (Mete Durlu) [RHEL-50799] - redhat: configs: common: generic: Clean up EM28XX that are masked behind CONFIG_VIDEO_EM28XX (Kate Hsuan) - redhat/configs: Update powerpc NR_CPUS config (Mamatha Inamdar) - redhat: use stricter rule for kunit.ko (Jan Stancek) - filtermod: fix clk kunit test and kunit location (Nico Pache) - redhat/configs: enable xr_serial on rhel (Desnes Nunes) - redhat/configs: enable ATH12K for rhel (Jose Ignacio Tornos Martinez) - redhat: configs: rhel: generic: x86: Enable IPU6 based MIPI cameras (Kate Hsuan) - os-build: enable CONFIG_SCHED_CLASS_EXT for RHEL (Phil Auld) - Fedora 6.12 configs part 1 (Justin M. Forbes) - redhat: set new gcov configs (Jan Stancek) - Don't ignore gitkeep files for ark-infra (Don Zickus) - redhat/kernel.spec: don't clear entire libdir when building tools (Jan Stancek) - redhat/configs: enable usbip for rhel (Jose Ignacio Tornos Martinez) - redhat: create 'crashkernel=' addons for UKI (Vitaly Kuznetsov) - redhat: avoid superfluous quotes in UKI cmdline addones (Vitaly Kuznetsov) - fedora: arm: updates for 6.12 (Peter Robinson) - redhat/configs: add bootconfig to kernel-tools package (Brian Masney) - Enable CONFIG_SECURITY_LANDLOCK for RHEL (Zbigniew Jędrzejewski-Szmek) [RHEL-8810] - redhat: configs: Drop CONFIG_MEMSTICK_REALTEK_PCI config option (Desnes Nunes) - Update the RHEL_DIFFERENCES help string (Don Zickus) - Put build framework for RT kernel in place for Fedora (Clark Williams) - generic: enable RPMB for all configs that enable MMC (Peter Robinson) - fedora: riscv: Don't override MMC platform defaults (Peter Robinson) - common: only enable on MMC_DW_BLUEFIELD (Peter Robinson) - fedora: aarch64: Stop overriding CONFIG_MMC defaults (Peter Robinson) - commong: The KS7010 driver has been removed (Peter Robinson) - Trim Changelog for 6.12 (Justin M. Forbes) - Enable CONFIG_SECURITY_IPE for Fedora (Zbigniew Jędrzejewski-Szmek) - redhat: allow to override VERSION_ON_UPSTREAM from command line (Jan Stancek) - redhat: configs: Enable CONFIG_SECURITY_TOMOYO in Fedora kernels (Tetsuo Handa) - Revert "Merge branch 'enablement/gpio-expander' into 'os-build'" (Justin M. Forbes) - redhat: configs: decrease CONFIG_PCP_BATCH_SCALE_MAX (Rafael Aquini) - redhat/configs: Enable CONFIG_RCU_TRACE in Fedora/REHL kernels (Waiman Long) - fedora: distable RTL8192E wifi driver (Peter Robinson) - common: arm64: Fixup and cleanup some SCMI options (Peter Robinson) - common: Cleanup ARM_SCMI_TRANSPORT options (Peter Robinson) - configs: fedora/x86: Set CONFIG_CRYPTO_DEV_CCP_DD=y (Hans de Goede) - Turn on ZRAM_WRITEBACK for Fedora (Justin M. Forbes) - configs: rhel: Fix designware I2C controllers related config settings (Hans de Goede) - Enable CONFIG_DMA_NUMA_CMA for x86_64 and aarch64 (Chris von Recklinghausen) - new config in drivers/phy (Izabela Bakollari) - configs: fedora: Unset CONFIG_I2C_DESIGNWARE_CORE on s390x (Hans de Goede) - configs: fedora: Drop duplicate CONFIG_I2C_DESIGNWARE_CORE for x86_64 and aarch64 (Hans de Goede) - Enable DESIGNWARE_CORE for ppc as well (Justin M. Forbes) - Fix up I2C_DESIGNWARE_CORE config for Fedora (Justin M. Forbes) - configs for RT deps (Clark Williams) - CONFIG_OF_OVERLAY: enable for aarch64 and powerpc (Scott Weaver) - redhat: enable changes to build rt variants (Clark Williams) - redhat: clean up pending-rhel (Patrick Talbert) - Enable CONFIG_SCHED_CLASS_EXT for Fedora (Jose Fernandez) - redhat/configs: new config in arch/s390 (Izabela Bakollari) - redhat: ignore rpminspect runpath report on selftests/bpf/cpuv4/urandom_read (Viktor Malik) - [fedora] configs: add end of file newline to CONFIG_DMADEVICES_VDEBUG (Patrick Talbert) - unset CONFIG_DMADEVICES_VDEBUG (cmurf) - stop installing tools/build/Build, gone with ea974028a049f (Thorsten Leemhuis) - redhat/configs: Update LOCKDEP configs (Waiman Long) - uki-virt: Add i18n module (Vitaly Kuznetsov) - uki-virt: Drop DBUS support from initramfs (Vitaly Kuznetsov) - uki-virt: Drop redundant modules from dracut-virt.conf (Vitaly Kuznetsov) - uki-virt: Drop usrmount dracut module (Vitaly Kuznetsov) - redhat: new AMCC_QT2025_PHY config in drivers/net/phy (Patrick Talbert) - redhat: change schedule jobs image from cki-tools to builder-rawhide (Patrick Talbert) - Add CONFIG_SND_SOC_RT1320_SDW to pending-rhel for mismatch (Justin M. Forbes) - Turn on CONFIG_SND_SOC_RT1320_SDW in pending rhel (Justin M. Forbes) - configs: disable CONFIG_AMCC_QT2025_PHY in pending (Patrick Talbert) - fedora: turn on CONFIG_FDMA for powerpc (Patrick Talbert) - Turn on CONFIG_FDMA in pending for Fedora arm and riscv to avoid a mismatch (Justin M. Forbes) - Reset RHEL_RELEASE for 6.12 (Justin M. Forbes) - Consolidate configs into common for 6.11 kernels (Justin M. Forbes) - uki-virt: add systemd-cryptsetup module (Vitaly Kuznetsov) - redhat/docs: fix command to install missing build dependencies (Davide Cavalca) - spec: Respect rpmbuild --without debuginfo (Orgad Shaneh) - fedora/configs: enable GPIO expander drivers (Rupinderjit Singh) - redhat/configs: Switch to the Rust implementation of AX88796B_PHY driver for Fedora (Neal Gompa) - redhat: Turn on support for Rust code in Fedora (Neal Gompa) - Turn off RUST for risc-v (Justin M. Forbes) - gitlab-ci: allow failure of clang LTO pipelines (Michael Hofmann) - redhat/configs: Consolidate the CONFIG_KVM_BOOK3S_HV_P*_TIMING switches (Thomas Huth) - redhat/configs: Consolidate the CONFIG_KVM_SW_PROTECTED_VM switch (Thomas Huth) - redhat/configs: Consolidate the CONFIG_KVM_HYPERV switch (Thomas Huth) - redhat/configs: Consolidate the CONFIG_KVM_AMD_SEV switch (Thomas Huth) - Cleanup some riscv CONFIG locations (Justin M. Forbes) - Fix up pending riscv Fedora configs post merge (Justin M. Forbes) - fedora/configs: Enable SCMI configuration (Rupinderjit Singh) - Remove S390 special config for PHYLIB (Justin M. Forbes) - Disable ELN for riscv64 (Isaiah Stapleton) - redhat: add checks to ensure only building riscv64 on fedora (Isaiah Stapleton) - redhat: Add missing riscv fedora configs (Isaiah Stapleton) - Add riscv64 to the CI pipelines (Isaiah Stapleton) - redhat: Regenerate dist-self-test-data for riscv64 (Isaiah Stapleton) - redhat: Add riscv config changes for fedora (David Abdurachmanov) - redhat: Add support for riscv (David Abdurachmanov) - redhat: Do not include UKI addons twice (Vitaly Kuznetsov) - redhat: update gating.yml (Michael Hofmann) - Remove CONFIG_FSCACHE_DEBUG as it has been renamed (Justin M. Forbes) - Set Fedora configs for 6.11 (Justin M. Forbes) - redhat/configs: Microchip lan743x driver (Izabela Bakollari) - redhat: include resolve_btfids in kernel-devel (Jan Stancek) - redhat: workaround CKI cross compilation for scripts (Jan Stancek) - spec: fix "unexpected argument to non-parametric macro" warnings (Jan Stancek) - Add weakdep support to the kernel spec (Justin M. Forbes) - redhat: configs: disable PF_KEY in RHEL (Sabrina Dubroca) - crypto: akcipher - Disable signing and decryption (Vladis Dronov) [RHEL-54183] {CVE-2023-6240} - crypto: dh - implement FIPS PCT (Vladis Dronov) [RHEL-54183] - crypto: ecdh - disallow plain "ecdh" usage in FIPS mode (Vladis Dronov) [RHEL-54183] - crypto: seqiv - flag instantiations as FIPS compliant (Vladis Dronov) [RHEL-54183] - [kernel] bpf: set default value for bpf_jit_harden (Artem Savkov) [RHEL-51896] - fedora: disable CONFIG_DRM_WERROR (Patrick Talbert) - redhat/configs: Disable dlm in rhel configs (Andrew Price) - rhel: aarch64: enable required PSCI configs (Peter Robinson) - fedora: Enable AF8133J Magnetometer driver (Peter Robinson) - redhat: spec: add cachestat kselftest (Eric Chanudet) - redhat: hmac sign the UKI for FIPS (Vitaly Kuznetsov) - not upstream: Disable vdso getrandom when FIPS is enabled (Herbert Xu) - kernel: config: enable erofs lzma compression (Ian Kent) - fedora: disable RTL8192CU in Fedora (Peter Robinson) - redhat: Fix the ownership of /lib/modules/ directory (Vitaly Kuznetsov) - new configs in drivers/phy (Izabela Bakollari) - Add support to rh_waived cmdline boot parameter (Ricardo Robaina) [RHEL-26170] - redhat/configs: Disable gfs2 in rhel configs (Andrew Price) - redhat/uki_addons/virt: add common FIPS addon (Emanuele Giuseppe Esposito) - redhat/kernel.spec: add uki_addons to create UKI kernel cmdline addons (Emanuele Giuseppe Esposito) - rh_flags: fix failed when register_sysctl_sz rh_flags_table to kernel (Ricardo Robaina) [RHEL-52629] - redhat/dracut-virt.conf: add systemd-veritysetup module (Emanuele Giuseppe Esposito) - redhat/configs: enable CONFIG_LOCK_STAT on the debug kernels for aarch64 (Brian Masney) - redhat/configs: enable CONFIG_KEYBOARD_GPIO_POLLED for RHEL on aarch64 (Luiz Capitulino) - redhat/configs: fedora: Enable new Qualcomm configs (Andrew Halaney) - redhat/configs/fedora: set CONFIG_CRYPTO_CURVE25519_PPC64 (Dan Horák) - fedora: Updates for 6.11 merge (Peter Robinson) - fedora: enable new mipi sensors and devices (Peter Robinson) - arm64: enable CRYPTO_DEV_TEGRA on RHEL (Peter Robinson) - redhat/kernel.spec: fix file listed twice warning for "kernel" subdir (Jan Stancek) - redhat/configs: Double MAX_LOCKDEP_ENTRIES for RT debug kernels (Waiman Long) [RHEL-43425] - Support the first day after a rebase (Don Zickus) - Support 2 digit versions properly (Don Zickus) - Automation cleanups for rebasing rt-devel and automotive-devel (Don Zickus) - fedora: set CONFIG_REGULATOR_RZG2L_VBCTRL as a module for arm64 (Patrick Talbert) - gitlab-ci: restore bot pipeline behavior (Michael Hofmann) - redhat/kernel.spec: drop extra right curly bracket in kernel_kvm_package (Jan Stancek) - redhat/configs: enable gpio_keys driver for RHEL on aarch64 (Luiz Capitulino) - Move NET_VENDOR_MICROCHIP from common to rhel (Justin M. Forbes) - redhat/configs: enable some RTCs for RHEL on aarch64 (Luiz Capitulino) - redhat/configs: enable some regulators for RHEL (Luiz Capitulino) - redhat/config: disable CXL and CXLFLASH drivers (Dan Horák) - Fix up config mismatches in pending (Justin M. Forbes) - redhat/configs: Enable watchdog devices modelled by qemu (Richard W.M. Jones) [RHEL-40937] - rhel: cleanup unused media tuner configs (Peter Robinson) - all: cleanup MEDIA_CONTROLLER options (Peter Robinson) - redhat: kernel.spec: add s390x to livepatching kselftest builds (Joe Lawrence) - Flip CONFIG_DIMLIB back to inline (Justin M. Forbes) - Add vfio/nvgrace-gpu driver CONFIG to RHEL-9.5 ARM64 (Donald Dutile) - Enable CONFIG_RTC_DRV_TEGRA for RHEL (Luiz Capitulino) - redhat: rh_flags: declare proper static methods when !CONFIG_RHEL_DIFFERENCES (Rafael Aquini) - redhat: configs: enable CONFIG_TMPFS_QUOTA for both Fedora and RHEL (Rafael Aquini) - Fix up mismatches in the 6.11 merge window. (Justin M. Forbes) - Reset Changelog after rebase (Justin M. Forbes) - Reset RHEL_RELEASE for the 6.11 cycle (Justin M. Forbes) - redhat/configs: Enable CONFIG_VMWARE_VMCI/CONFIG_VMWARE_VMCI_VSOCKETS for RHEL (Vitaly Kuznetsov) - Consolidate configs to common for 6.10 (Justin M. Forbes) - redhat/configs: Enable CONFIG_PTP_1588_CLOCK_MOCK in kernel-modules-internal (Davide Caratti) - fedora: enabled XE GPU drivers on all arches (Peter Robinson) - Flip SND_SOC_CS35L56_SPI from off to module for RHEL (Justin M. Forbes) - Flip DIMLIB from built-in to module for RHEL (Justin M. Forbes) - Also remove the zfcpdump BASE_SMALL config (Justin M. Forbes) - redhat: Add cgroup kselftests to kernel-selftests-internal (Waiman Long) [RHEL-43556] - Revert "redhat/configs: Disable CONFIG_INFINIBAND_HFI1 and CONFIG_INFINIBAND_RDMAVT" (Kamal Heib) - Remove new for GITLAB_TOKEN (Don Zickus) - Set Fedora configs for 6.10 (Justin M. Forbes) - Fedora: minor driver updates (Peter Robinson) - redhat/configs: Remove obsolete x86 CPU mitigations config files (Waiman Long) - redhat/configs: increase CONFIG_DEFAULT_MMAP_MIN_ADDR from 32K to 64K for aarch64 (Brian Masney) - redhat/configs: Re-enable CONFIG_KEXEC for Fedora (Philipp Rudo) - disable LR_WPAN for RHEL10 (Chris von Recklinghausen) [RHEL-40251] - Turn on USB_SERIAL_F81232 for Fedora (Justin M. Forbes) - redhat/scripts/filtermods.py: show all parent/child kmods in report (Jan Stancek) - redhat/kernel.spec: capture filtermods.py return code (Jan Stancek) - redhat/kernel.spec: fix run of mod-denylist (Jan Stancek) - gitlab-ci: remove unused RHMAINTAINERS variable (Michael Hofmann) - gitlab-ci: use environments for jobs that need access to push/gitlab secrets (Michael Hofmann) - gitlab-ci: default to os-build for all maintenance jobs (Michael Hofmann) - gitlab-ci: use the common git repo setup cki-gating as well (Michael Hofmann) - gitlab-ci: help maintenance jobs to cope with missing private key (Michael Hofmann) - gitlab-ci: use a common git repo setup for all maintenance jobs (Michael Hofmann) - gitlab-ci: move repo setup script into script template holder (Michael Hofmann) - gitlab-ci: move maintenance job DIST variable into common template (Michael Hofmann) - gitlab-ci: move maintenance job rules into common template (Michael Hofmann) - gitlab-ci: move maintenance job retry field into common template (Michael Hofmann) - gitlab-ci: provide common non-secret schedule trigger variables (Michael Hofmann) - gitlab-ci: rename .scheduled_setup to .git_setup (Michael Hofmann) - gitlab-ci: move script snippets into separate template (Michael Hofmann) - gitlab-ci: rename maintenance jobs (Michael Hofmann) - gitlab-ci: introduce job template for maintenance jobs (Michael Hofmann) - Turn on KASAN_HW_TAGS for Fedora aarch64 debug kernels (Justin M. Forbes) - redhat: kernel.spec: add missing sound/soc/sof/sof-audio.h to kernel-devel package (Jaroslav Kysela) - redhat/kernel.spec: fix attributes of symvers file (Jan Stancek) - redhat: add filtermods rule for iommu tests (Jan Stancek) - fedora: arm: Enable basic support for S32G-VNP-RDB3 board (Enric Balletbo i Serra) - redhat: make bnx2xx drivers unmaintained in rhel-10 (John Meneghini) [RHEL-36646 RHEL-41231] - redhat/configs: Disable CONFIG_NFP (Kamal Heib) [RHEL-36647] - Enable CONFIG_PWRSEQ_{SIMPLIE,EMMC} on aarch64 (Charles Mirabile) - Fix SERIAL_SC16IS7XX configs for Fedora (Justin M. Forbes) - Enable ALSA (CONFIG_SND) on aarch64 (Charles Mirabile) [RHEL-40411] - redhat: Remove DIST_BRANCH variable (Eder Zulian) - gitlab-ci: merge ark-latest before tagging cki-gating (Michael Hofmann) - gitlab-ci: do not merge ark-latest for gating pipelines for Rawhide (Michael Hofmann) - disable CONFIG_KVM_INTEL_PROVE_VE (Paolo Bonzini) - redhat: remove the merge subtrees script (Derek Barbosa) - redhat: rhdocs: delete .get_maintainer.conf (Derek Barbosa) - redhat: rhdocs: Remove the rhdocs directory (Derek Barbosa) - redhat/configs: Disable CONFIG_QLA3XXX (Kamal Heib) [RHEL-36646] - redhat/configs: fedora: Enable some drivers for IPU6 support (Hans de Goede) - redhat: add missing UKI_secureboot_cert hunk (Patrick Talbert) - redhat/kernel.spec: keep extra modules in original directories (Jan Stancek) - redhat/configs: Move CONFIG_BLK_CGROUP_IOCOST=y to common/generic (Waiman Long) - Turn on CONFIG_MFD_QCOM_PM8008 for Fedora aarch64 (Justin M. Forbes) - redhat: Build IMA CA certificate into the Fedora kernel (Coiby Xu) - Move CONFIG_RAS_FMPM to the proper location (Aristeu Rozanski) - redhat/configs: Remove CONFIG_NET_ACT_IPT (Ivan Vecera) - gitlab-ci: add kernel-automotive pipelines (Michael Hofmann) - Enable CEC support for TC358743 (Peter Robinson) - fedora: arm: Enable ARCH_R9A09G057 (Peter Robinson) - fedora: updates for the 6.10 kernel (Peter Robinson) - fedora: arm: Enable the MAX96706 GMSL module (Peter Robinson) - redhat: Switch UKI to using its own SecureBoot cert (from system-sb-certs) (Jan Stancek) - redhat: Add RHEL specifc .sbat section to UKI (Jan Stancek) - kernel.spec: add iommu selftests to kernel-selftests-internal (Eder Zulian) [RHEL-32895] - redhat/configs: fedora: aarch64: Re-enable CUSE (Neal Gompa) - redhat: pass correct RPM_VMLINUX_H to bpftool install (Jan Stancek) - rh_flags: Rename rh_features to rh_flags (Ricardo Robaina) [RHEL-32987] - kernel: rh_features: fix reading empty feature list from /proc (Ricardo Robaina) [RHEL-32987] - rh_features: move rh_features entry to sys/kernel (Ricardo Robaina) [RHEL-32987] - rh_features: convert to atomic allocation (Ricardo Robaina) [RHEL-32987] - add rh_features to /proc (Ricardo Robaina) [RHEL-32987] - add support for rh_features (Ricardo Robaina) [RHEL-32987] - Drop kexec_load syscall support (Baoquan He) - New configs in lib/kunit (Fedora Kernel Team) - Turn off KUNIT_FAULT_TEST as it causes problems for CI (Justin M. Forbes) - Add a config entry in pending for CONFIG_DRM_MSM_VALIDATE_XML (Justin M. Forbes) - Flip CONFIG_SND_SOC_CS35L56_SPI in pending to avoid a mismatch (Justin M. Forbes) - Fix up a mismatch for RHEL (Justin M. Forbes) - Reset changelog after rebase (Justin M. Forbes) - Reset RHEL_RELEASE to 0 for 6.10 (Justin M. Forbes) - configs: move CONFIG_BLK_DEV_UBLK into rhel/configs/generic (Ming Lei) - configs: move CONFIG_BLK_SED_OPAL into redhat/configs/common/generic (Ming Lei) - RHEL-21097: rhel: aarch64 stop blocking a number of HW sensors (Peter Robinson) - redhat/configs: enable RTL8822BU for rhel (Jose Ignacio Tornos Martinez) - redhat/configs: remove CONFIG_DMA_PERNUMA_CMA and switch CONFIG_DMA_NUMA_CMA off (Jerry Snitselaar) - redhat: add IMA certificates (Jan Stancek) - redhat/kernel.spec: fix typo in move_kmod_list() variable (Jan Stancek) - redhat: make filtermods.py less verbose by default (Jan Stancek) - scsi: sd: condition probe_type under RHEL_DIFFERENCES (Eric Chanudet) - scsi: sd: remove unused sd_probe_types (Eric Chanudet) - Turn on INIT_ON_ALLOC_DEFAULT_ON for Fedora (Justin M. Forbes) - Consolidate configs to common for 6.9 (Justin M. Forbes) - redhat/rhel_files: move tipc.ko and tipc_diag.ko to modules-extra (Xin Long) [RHEL-23931] - redhat: move amd-pstate-ut.ko to modules-internal (Jan Stancek) - redhat/configs: enable CONFIG_LEDS_TRIGGER_NETDEV also for RHEL (Michal Schmidt) [RHEL-32110] - redhat/configs: Remove CONFIG_AMD_IOMMU_V2 (Jerry Snitselaar) - Set DEBUG_INFO_BTF_MODULES for Fedora (Justin M. Forbes) - redhat: Use redhatsecureboot701 for ppc64le (Jan Stancek) - redhat: switch the kernel package to use certs from system-sb-certs (Jan Stancek) - redhat: replace redhatsecureboot303 signing key with redhatsecureboot601 (Jan Stancek) - redhat: drop certificates that were deprecated after GRUB's BootHole flaw (Jan Stancek) - redhat: correct file name of redhatsecurebootca1 (Jan Stancek) - redhat: align file names with names of signing keys for ppc and s390 (Jan Stancek) - redhat/configs: Enable CONFIG_DM_VDO in RHEL (Benjamin Marzinski) - redhat/configs: Enable DRM_NOUVEAU_GSP_DEFAULT everywhere (Neal Gompa) - kernel.spec: adjust for livepatching kselftests (Joe Lawrence) - redhat/configs: remove CONFIG_TEST_LIVEPATCH (Joe Lawrence) - Turn on CONFIG_RANDOM_KMALLOC_CACHES for Fedora (Justin M. Forbes) - Set Fedora configs for 6.9 (Justin M. Forbes) - gitlab-ci: enable pipelines with c10s buildroot (Michael Hofmann) - Turn on ISM for Fedora (Justin M. Forbes) - redhat/configs: enable CONFIG_TEST_LOCKUP for non-debug kernels (Čestmír Kalina) - redhat/rhel_files: add test_lockup.ko to modules-extra (Čestmír Kalina) - Turn off some Fedora UBSAN options to avoid false positives (Justin M. Forbes) - fedora: aarch64: Enable a QCom Robotics platforms requirements (Peter Robinson) - fedora: updates for 6.9 merge window (Peter Robinson) - gitlab-ci: rename GitLab jobs ark -> rawhide (Michael Hofmann) - gitlab-ci: harmonize DataWarehouse tree names (Michael Hofmann) - redhat/configs: Enable CONFIG_INTEL_IOMMU_SCALABLE_MODE_DEFAULT_ON for rhel (Jerry Snitselaar) - spec: make sure posttrans script doesn't fail if /boot is non-POSIX (glb) - Turn on UBSAN for Fedora (Justin M. Forbes) - Turn on XEN_BALLOON_MEMORY_HOTPLUG for Fedora (Justin M. Forbes) - docs: point out that python3-pyyaml is now required (Thorsten Leemhuis) - Use LLVM=1 for clang_lto build (Nikita Popov) - redhat: fix def_variants.yaml check (Jan Stancek) - redhat: sanity check yaml files (Jan Stancek) - spec: rework filter-mods and mod-denylist (Jan Stancek) - redhat/configs: remove CONFIG_INTEL_MENLOW as it is obsolete. (David Arcari) - arch/x86: Fix XSAVE check for x86_64-v2 check (Prarit Bhargava) - redhat/Makefile.variables: unquote a variable (Thorsten Leemhuis) - redhat/configs: build in Tegra210 SPI driver (Mark Salter) - redhat/configs: aarch64: Enable ARM_FFA driver (Mark Salter) - Base automotive-devel on rt-devel (Don Zickus) - redhat/configs: Enable CONFIG_AMDTEE for x86 (David Arcari) - redhat/configs: enable CONFIG_TEST_LOCKUP for debug kernel (Čestmír Kalina) - kernel.spec: fix libperf-debuginfo content (Jan Stancek) - Turn on DM_VDO for Fedora (Justin M. Forbes) - redhat: make libperf-devel require libperf %{version}-%{release} (Jan Stancek) - kernel.spec: drop custom mode also for System.map ghost entry (Jan Stancek) - Octopus merges are too conservative, serialize instead (Don Zickus) - Add tracking branches for rt-devel (Don Zickus) - all: clean-up i915 (Peter Robinson) - Turn on CONFIG_READ_ONLY_THP_FOR_FS for Fedora (Justin M. Forbes) - redhat/kernel.spec.template: fix rtonly build (Jan Stancek) - redhat/kernel.spec.template: add extra flags for tools build (Scott Weaver) - Add iio-test-gts to mod-internal.list (Thorsten Leemhuis) - redhat/kernel.spec.template: update license (Scott Weaver) - Fix typo in maintaining.rst file (Augusto Caringi) - Enable DRM_CDNS_DSI_J721E for fedora (Andrew Halaney) - gitlab-ci: do not merge ark-latest for gating pipelines (Michael Hofmann) - fedora: Enable MCP9600 (Peter Robinson) - redhat/configs: Enable & consolidate BF-3 drivers config (Luiz Capitulino) - redhat: Fix RT kernel kvm subpackage requires (Juri Lelli) - Add new of_test module to mod-internal.list (Thorsten Leemhuis) - Add new string kunit modules to mod-internal.list (Thorsten Leemhuis) - redhat/kernel.spec.template: enable cross for base/RT (Peter Robinson) - redhat/kernel.spec.template: Fix cross compiling (Peter Robinson) - arch/x86/kernel/setup.c: fixup rh_check_supported (Scott Weaver) - Enable CONFIG_USB_ONBOARD_HUB for RHEL (Charles Mirabile) - redhat/Makefile.cross: Add CROSS_BASEONLY (Prarit Bhargava) - gitlab-ci: fix ark-latest merging for parent pipelines running in forks (Michael Hofmann) - lsm: update security_lock_kernel_down (Scott Weaver) - Fix changelog after rebase (Augusto Caringi) - redhat: remove "END OF CHANGELOG" marker from kernel.changelog (Herton R. Krzesinski) - gitlab-ci: enable all variants for rawhide/eln builder image gating (Michael Hofmann) - Fedora: enable Microchip and their useful drivers (Peter Robinson) - spec: suppress "set +x" output (Jan Stancek) - redhat/configs: Disable CONFIG_RDMA_SIW (Kamal Heib) - redhat/configs: Disable CONFIG_RDMA_RXE (Kamal Heib) - redhat/configs: Disable CONFIG_MLX4 (Kamal Heib) - redhat/configs: Disable CONFIG_INFINIBAND_HFI1 and CONFIG_INFINIBAND_RDMAVT (Kamal Heib) - Consolidate 6.8 configs to common (Justin M. Forbes) - Remove rt-automated and master-rt-devel logic (Don Zickus) - Add support for CI octopus merging (Don Zickus) - redhat/configs: Disable CONFIG_INFINIBAND_VMWARE_PVRDMA (Kamal Heib) - gitlab-ci: fix merge tree URL for gating pipelines (Michael Hofmann) - Revert "net: bump CONFIG_MAX_SKB_FRAGS to 45" (Marcelo Ricardo Leitner) - uki: use systemd-pcrphase dracut module (Gerd Hoffmann) - Add libperf-debuginfo subpackage (Justin M. Forbes) - redhat/kernel.spec.template: Add log_msg macro (Prarit Bhargava) - redhat/configs: Disable CONFIG_INFINIBAND_USNIC (Kamal Heib) - Enable CONFIG_BMI323_I2C=m for Fedora x86_64 builds (Hans de Goede) - gitlab-ci: drop test_makefile job (Scott Weaver) - Enable merge-rt pipeline (Don Zickus) - kernel.spec: include the GDB plugin in kernel-debuginfo (Ondrej Mosnacek) - Turn on DRM_NOUVEAU_GSP_DEFAULT for Fedora (Justin M. Forbes) - Set late new config HDC3020 for Fedora (Justin M. Forbes) - redhat/self-test: Update CROSS_DISABLED_PACKAGES (Prarit Bhargava) - redhat: Do not build libperf with cross builds (Prarit Bhargava) - redhat/configs: enable CONFIG_PINCTRL_INTEL_PLATFORM for RHEL (David Arcari) - redhat/configs: enable CONFIG_PINCTRL_METEORPOINT for RHEL (David Arcari) - redhat/configs: intel pinctrl config cleanup (David Arcari) - redhat/configs: For aarch64/RT, default kstack randomization off (Jeremy Linton) - redhat/Makefile: remove an unused target (Ondrej Mosnacek) - redhat/Makefile: fix setup-source and document its caveat (Ondrej Mosnacek) - redhat/Makefile: fix race condition when making the KABI tarball (Ondrej Mosnacek) - redhat/Makefile: refactor KABI tarball creation (Ondrej Mosnacek) - Turn XFS_SUPPORT_V4 back on for Fedora (Justin M. Forbes) - Add xe to drm module filters (Justin M. Forbes) - Turn off the DRM_XE_KUNIT_TEST for Fedora (Justin M. Forbes) - Flip secureboot signature order (Justin M. Forbes) - all: clean up some removed configs (Peter Robinson) - redhat: add nvidia oot signing key (Dave Airlie) - gitlab-ci: support CI for zfcpdump kernel on ELN (Michael Hofmann) - Fedora configs for 6.8 (Justin M. Forbes) - Turn off CONFIG_INTEL_VSC for Fedora (Justin M. Forbes) - redhat/configs: rhel wireless requests (Jose Ignacio Tornos Martinez) - spec: Set EXTRA_CXXFLAGS for perf demangle-cxx.o (Josh Stone) [2233269] - Flip values for FSCACHE and NETFS_SUPPORT to avoid mismatch (Justin M. Forbes) - Turn on SECURITY_DMESG_RESTRICT (Justin M. Forbes) - redhat: forward-port genlog.py updates from c9s (Jan Stancek) - arch/x86: mark x86_64-v1 and x86_64-v2 processors as deprecated (Prarit Bhargava) - fedora: Enable more Renesas RZ platform drivers (Peter Robinson) - fedora: a few aarch64 drivers and cleanups (Peter Robinson) - fedora: cavium nitrox cnn55xx (Peter Robinson) - Fix dist-get-buildreqs breakage around perl(ExtUtils::Embed) (Don Zickus) - gitlab-ci: merge ark-latest fixes when running ELN pipelines (Michael Hofmann) - gitlab-ci: use all arches for container image gating (Michael Hofmann) - Add new os-build targets: rt-devel and automotive-devel (Don Zickus) - Remove defines forcing tools on, they override cmdline (Justin M. Forbes) - Remove separate license tag for libperf (Justin M. Forbes) - Don't use upstream bpftool version for Fedora package (Justin M. Forbes) - Don't ship libperf.a in libperf-devel (Justin M. Forbes) - add libperf packages and enable perf, libperf, tools and bpftool packages (Thorsten Leemhuis) - Add scaffolding to build the kernel-headers package for Fedora (Justin M. Forbes) - redhat/spec: use distro CFLAGS when building bootstrap bpftool (Artem Savkov) - spec: use just-built bpftool for vmlinux.h generation (Yauheni Kaliuta) [2120968] - gitlab-ci: enable native tools for Rawhide CI (Michael Hofmann) - Revert "Merge branch 'fix-kabi-build-race' into 'os-build'" (Justin M. Forbes) - redhat: configs: fedora: Enable sii902x bridge chip driver (Erico Nunes) - Enable CONFIG_TCP_CONG_ILLINOIS for RHEL (Davide Caratti) - redhat/Makefile: fix setup-source and document its caveat (Ondrej Mosnacek) - redhat/Makefile: fix race condition when making the KABI tarball (Ondrej Mosnacek) - redhat/Makefile: refactor KABI tarball creation (Ondrej Mosnacek) - redhat/configs: Remove HOTPLUG_CPU0 configs (Prarit Bhargava) - gitlab-ci: merge ark-latest before building in MR pipelines (Michael Hofmann) - CI: include aarch64 in CKI container image gating (Tales Aparecida) - redhat: spec: Fix update_scripts run for CentOS builds (Neal Gompa) - New configs in drivers/crypto (Fedora Kernel Team) - net: bump CONFIG_MAX_SKB_FRAGS to 45 (Marcelo Ricardo Leitner) - Enable CONFIG_MARVELL_88Q2XXX_PHY (Izabela Bakollari) - Remove CONFIG_NET_EMATCH_STACK file for RHEL (Justin M. Forbes) - CONFIG_NETFS_SUPPORT should be m after the merge (Justin M. Forbes) - Turn FSCACHE and NETFS from m to y in pending (Justin M. Forbes) - Turn on CONFIG_TCP_AO for Fedora (Justin M. Forbes) - Turn on IAA_CRYPTO_STATS for Fedora (Justin M. Forbes) - fedora: new drivers and cleanups (Peter Robinson) - Turn on Renesas RZ for Fedora IOT rhbz2257913 (Justin M. Forbes) - redhat: filter-modules.sh.rhel: add dell-smm-hwmon (Scott Weaver) - Add CONFIG_INTEL_MEI_GSC_PROXY=m for DRM 9.4 stable backport (Mika Penttilä) - Set configs for ZRAM_TRACK_ENTRY_ACTIME (Justin M. Forbes) - Add python3-pyyaml to buildreqs for kernel-docs (Justin M. Forbes) - Add nb7vpq904m to singlemods for ppc64le (Thorsten Leemhuis) - include drm bridge helpers in kernel-core package (Thorsten Leemhuis) - Add dell-smm-hwmon to singlemods (Thorsten Leemhuis) - Add drm_gem_shmem_test to mod-internal.list (Thorsten Leemhuis) - redhat: kABI: add missing RH_KABI_SIZE_ALIGN_CHECKS Kconfig option (Sabrina Dubroca) - redhat: rh_kabi: introduce RH_KABI_EXCLUDE_WITH_SIZE (Sabrina Dubroca) - redhat: rh_kabi: move semicolon inside __RH_KABI_CHECK_SIZE (Sabrina Dubroca) - Fix up ZRAM_TRACK_ENTRY_ACTIME in pending (Justin M. Forbes) - random: replace import_single_range() with import_ubuf() (Justin M. Forbes) - Flip CONFIG_INTEL_PMC_CORE to m for Fedora (Justin M. Forbes) - Add CONFIG_ZRAM_TRACK_ENTRY_ACTIME=y to avoid a mismatch (Justin M. Forbes) - common: cleanup MX3_IPU (Peter Robinson) - all: The Octeon MDIO driver is aarch64/mips (Peter Robinson) - common: rtc: remove bq4802 config (Peter Robinson) - common: de-dupe MARVELL_GTI_WDT (Peter Robinson) - all: Remove CAN_BXCAN (Peter Robinson) - common: cleanup SND_SOC_ROCKCHIP (Peter Robinson) - common: move RHEL DP83867_PHY to common (Peter Robinson) - common: Make ASYMMETRIC_KEY_TYPE enable explicit (Peter Robinson) - common: Disable aarch64 ARCH_MA35 universally (Peter Robinson) - common: arm64: enable Tegra234 pinctrl driver (Peter Robinson) - rhel: arm64: Enable qoriq thermal driver (Peter Robinson) - common: aarch64: Cleanup some i.MX8 config options (Peter Robinson) - all: EEPROM_LEGACY has been removed (Peter Robinson) - all: rmeove AppleTalk hardware configs (Peter Robinson) - all: cleanup: remove references to SLOB (Peter Robinson) - all: cleanup: Drop unnessary BRCMSTB configs (Peter Robinson) - all: net: remove retired network schedulers (Peter Robinson) - all: cleanup removed CONFIG_IMA_TRUSTED_KEYRING (Peter Robinson) - BuildRequires: lld for build with selftests for x86 (Jan Stancek) - spec: add keyutils to selftest-internal subpackage requirements (Artem Savkov) [2166911] - redhat/spec: exclude liburandom_read.so from requires (Artem Savkov) [2120968] - rtla: sync summary text with upstream and update Requires (Jan Stancek) - uki-virt: add systemd-sysext dracut module (Gerd Hoffmann) - uki-virt: add virtiofs dracut module (Gerd Hoffmann) - common: disable the FB device creation (Peter Robinson) - s390x: There's no FB on Z-series (Peter Robinson) - fedora: aarch64: enable SM_VIDEOCC_8350 (Peter Robinson) - fedora: arm64: enable ethernet on newer TI industrial (Peter Robinson) - fedora: arm64: Disable VIDEO_IMX_MEDIA (Peter Robinson) - fedora: use common config for Siemens Simatic IPC (Peter Robinson) - fedora: arm: enable Rockchip SPI flash (Peter Robinson) - fedora: arm64: enable DRM_TI_SN65DSI83 (Peter Robinson) - kernel.spec: remove kernel-smp reference from scripts (Jan Stancek) - redhat: do not compress the full kernel changelog in the src.rpm (Herton R. Krzesinski) - Auto consolidate configs for the 6.7 cycle (Justin M. Forbes) - Enable sound for a line of Huawei laptops (TomZanna) - fedora: a few cleanups and driver enablements (Peter Robinson) - fedora: arm64: cleanup Allwinner Pinctrl drivers (Peter Robinson) - fedora: aarch64: Enable some DW drivers (Peter Robinson) - redhat: ship all the changelog from source git into kernel-doc (Herton R. Krzesinski) - redhat: create an empty changelog file when changing its name (Herton R. Krzesinski) - redhat/self-test: Remove --all from git query (Prarit Bhargava) - Disable accel drivers for Fedora x86 (Kate Hsuan) - redhat: scripts: An automation script for disabling unused driver for x86 (Kate Hsuan) - Fix up Fedora LJCA configs and filters (Justin M. Forbes) - Fedora configs for 6.7 (Justin M. Forbes) - Some Fedora config updates for MLX5 (Justin M. Forbes) - Turn on DRM_ACCEL drivers for Fedora (Justin M. Forbes) - redhat: enable the kfence test (Nico Pache) - redhat/configs: Enable UCLAMP_TASK for PipeWire and WirePlumber (Neal Gompa) - Turn on CONFIG_SECURITY_DMESG_RESTRICT for Fedora (Justin M. Forbes) - Turn off shellcheck for the fedora-stable-release script (Justin M. Forbes) - Add some initial Fedora stable branch script to redhat/scripts/fedora/ (Justin M. Forbes) - redhat: disable iptables-legacy compatibility layer (Florian Westphal) - redhat: disable dccp conntrack support (Florian Westphal) - configs: enable netfilter_netlink_hook in fedora too (Florian Westphal) - ext4: Mark mounting fs-verity filesystems as tech-preview (Alexander Larsson) - erofs: Add tech preview markers at mount (Alexander Larsson) - Enable fs-verity (Alexander Larsson) - Enable erofs (Alexander Larsson) - aarch64: enable uki (Gerd Hoffmann) - redhat: enable CONFIG_SND_SOC_INTEL_SOF_DA7219_MACH as a module for x86 (Patrick Talbert) - Turn CONFIG_MFD_CS42L43_SDW on for RHEL (Justin M. Forbes) - Enable cryptographic acceleration config flags for PowerPC (Mamatha Inamdar) - Also make vmlinuz-virt.efi world readable (Zbigniew Jędrzejewski-Szmek) - Drop custom mode for System.map file (Zbigniew Jędrzejewski-Szmek) - Add drm_exec_test to mod-internal.list for depmod to succeed (Mika Penttilä) - RHEL 9.4 DRM backport (upto v6.6 kernel), sync Kconfigs (Mika Penttilä) - Turn on USB_DWC3 for Fedora (rhbz 2250955) (Justin M. Forbes) - redhat/configs: Move IOMMUFD to common (Alex Williamson) - redhat: Really remove cpupower files (Prarit Bhargava) - redhat: remove update_scripts.sh (Prarit Bhargava) - Fix s390 zfcpfdump bpf build failures for cgroups (Don Zickus) - Flip CONFIG_NVME_AUTH to m in pending (Justin M. Forbes) - Turn CONFIG_SND_SOC_INTEL_AVS_MACH_RT5514 on for Fedora x86 (Jason Montleon) - kernel/rh_messages.c: Mark functions as possibly unused (Prarit Bhargava) - Add snd-hda-cirrus-scodec-test to mod-internal.list (Scott Weaver) - Turn off BPF_SYSCALL in pending for zfcpdump (Justin M. Forbes) - Add mean_and_variance_test to mod-internal.list (Justin M. Forbes) - Add cfg80211-tests and mac80211-tests to mod-internal.list (Justin M. Forbes) - Turn on CONFIG_MFD_CS42L43_SDW for RHEL in pending (Justin M. Forbes) - Turn on bcachefs for Fedora (Justin M. Forbes) - redhat: configs: fedora: Enable QSEECOM and friends (Andrew Halaney) - Add clk-fractional-divider_test to mod-internal.list (Thorsten Leemhuis) - Add gso_test to mod-internal.list (Thorsten Leemhuis) - Add property-entry-test to mod-internal.list (Thorsten Leemhuis) - Fedora 6.7 configs part 1 (Justin M. Forbes) - [Scheduled job] Catch config mismatches early during upstream merge (Don Zickus) - redhat/self-test: Update data for KABI xz change (Prarit Bhargava) - redhat/scripts: Switch KABI tarballs to xz (Prarit Bhargava) - redhat/kernel.spec.template: Switch KABI compression to xz (Prarit Bhargava) - redhat: self-test: Use a more complete SRPM file suffix (Andrew Halaney) - redhat: makefile: remove stray rpmbuild --without (Eric Chanudet) - Consolidate configs into common for 6.6 (Justin M. Forbes) - Updated Fedora configs (Justin M. Forbes) - Turn on UFSHCD for Fedora x86 (Justin M. Forbes) - redhat: configs: generic: x86: Disable CONFIG_VIDEO_OV01A10 for x86 platform (Hans de Goede) - redhat: remove pending-rhel CONFIG_XFS_ASSERT_FATAL file (Patrick Talbert) - New configs in fs/xfs (Fedora Kernel Team) - crypto: rng - Override drivers/char/random in FIPS mode (Herbert Xu) - random: Add hook to override device reads and getrandom(2) (Herbert Xu) - redhat/configs: share CONFIG_ARM64_ERRATUM_2966298 between rhel and fedora (Mark Salter) - configs: Remove S390 IOMMU config options that no longer exist (Jerry Snitselaar) - redhat: docs: clarify where bugs and issues are created (Scott Weaver) - redhat/scripts/rh-dist-git.sh does not take any arguments: fix error message (Denys Vlasenko) - Add target_branch for gen_config_patches.sh (Don Zickus) - redhat: disable kunit by default (Nico Pache) - redhat/configs: enable the AMD_PMF driver for RHEL (David Arcari) - Make CONFIG_ADDRESS_MASKING consistent between fedora and rhel (Chris von Recklinghausen) - CI: add ark-latest baseline job to tag cki-gating for successful pipelines (Michael Hofmann) - CI: provide child pipelines for CKI container image gating (Michael Hofmann) - CI: allow to run as child pipeline (Michael Hofmann) - CI: provide descriptive pipeline name for scheduled pipelines (Michael Hofmann) - CI: use job templates for variant variables (Michael Hofmann) - redhat/kernel.spec.template: simplify __modsign_install_post (Jan Stancek) - Fedora filter updates after configs (Justin M. Forbes) - Fedora configs for 6.6 (Justin M. Forbes) - redhat/configs: Freescale Layerscape SoC family (Steve Best) - Add clang MR/baseline pipelines (Michael Hofmann) - CI: Remove unused kpet_tree_family (Nikolai Kondrashov) - Add clang config framework (Don Zickus) - Apply partial snippet configs to all configs (Don Zickus) - Remove unpackaged kgcov config files (Don Zickus) - redhat/configs: enable missing Kconfig options for Qualcomm RideSX4 (Brian Masney) - enable CONFIG_ADDRESS_MASKING for x86_64 (Chris von Recklinghausen) - common: aarch64: enable NXP Flex SPI (Peter Robinson) - fedora: Switch TI_SCI_CLK and TI_SCI_PM_DOMAINS symbols to built-in (Javier Martinez Canillas) - kernel.spec: adjust build option comment (Michael Hofmann) - kernel.spec: allow to enable arm64_16k variant (Michael Hofmann) - gitlab-ci: enable build-only pipelines for Rawhide/16k/aarch64 (Michael Hofmann) - kernel.spec.template: Fix --without bpftool (Prarit Bhargava) - redhat/configs: NXP BBNSM Power Key Driver (Steve Best) - redhat/self-test: Update data for cross compile fields (Prarit Bhargava) - redhat/Makefile.cross: Add message for disabled subpackages (Prarit Bhargava) - redhat/Makefile.cross: Update cross targets with disabled subpackages (Prarit Bhargava) - Remove XFS_ASSERT_FATAL from pending-fedora (Justin M. Forbes) - Change default pending for XFS_ONLINE_SCRUB_STATSas it now selects XFS_DEBUG (Justin M. Forbes) - gitlab-ci: use --with debug/base to select kernel variants (Michael Hofmann) - kernel.spec: add rpmbuild --without base option (Michael Hofmann) - redhat: spec: Fix typo for kernel_variant_preun for 16k-debug flavor (Neal Gompa) - Turn off appletalk for fedora (Justin M. Forbes) - New configs in drivers/media (Fedora Kernel Team) - redhat/docs: Add a mention of bugzilla for bugs (Prarit Bhargava) - Fix the fixup of Fedora release (Don Zickus) - Fix Fedora release scheduled job (Don Zickus) - Move squashfs to kernel-modules-core (Justin M. Forbes) - redhat: Explicitly disable CONFIG_COPS (Vitaly Kuznetsov) - redhat: Add dist-check-licenses target (Vitaly Kuznetsov) - redhat: Introduce "Verify SPDX-License-Identifier tags" selftest (Vitaly Kuznetsov) - redhat: Use kspdx-tool output for the License: field (Vitaly Kuznetsov) - Rename pipeline repo branch and DW tree names (Michael Hofmann) - Adjust comments that refer to ARK in a Rawhide context (Michael Hofmann) - Rename variable names starting with ark- to rawhide- (Michael Hofmann) - Rename trigger-ark to trigger-rawhide (Michael Hofmann) - Fix up config mismatches for Fedora (Justin M. Forbes) - redhat/configs: Texas Instruments Inc. K3 multicore SoC architecture (Steve Best) - Flip CONFIG_VIDEO_V4L2_SUBDEV_API in pending RHEL due to mismatch (Justin M. Forbes) - CONFIG_HW_RANDOM_HISI: move to common and set to m (Scott Weaver) - Turn off CONFIG_MEMORY_HOTPLUG_DEFAULT_ONLINE for Fedora s390x (Justin M. Forbes) - Disable tests for ELN realtime pipelines (Michael Hofmann) - New configs in mm/Kconfig (Fedora Kernel Team) - Flip CONFIG_SND_SOC_CS35L56_SDW to m and clean up (Justin M. Forbes) - Add drm_exec_test to mod-internal.list (Thorsten Leemhuis) - Add new pending entry for CONFIG_SND_SOC_CS35L56_SDW to fix mismatch (Justin M. Forbes) - Fix tarball creation logic (Don Zickus) - redhat: bump libcpupower soname to match upstream (Patrick Talbert) - Turn on MEMFD_CREATE in pending as it is selected by CONFIG_TMPFS (Justin M. Forbes) - redhat: drop unneeded build-time dependency gcc-plugin-devel (Coiby Xu) - all: x86: move wayward x86 specific config home (Peter Robinson) - all: de-dupe non standard config options (Peter Robinson) - all: x86: clean up microcode loading options (Peter Robinson) - common: remove unnessary CONFIG_SND_MESON_AXG* (Peter Robinson) - redhat: Fix UKI install with systemd >= 254 (Vitaly Kuznetsov) - redhat: Use named parameters for kernel_variant_posttrans()/kernel_variant_preun() (Vitaly Kuznetsov) - redhat/kernel.spec.template: update compression variables to support zstd (Brian Masney) - Consolidate configs to common for 6.5 (Justin M. Forbes) - Remove unused config entry for Fedora (Justin M. Forbes) - redhat/self-test: Remove rpmlint test (Prarit Bhargava) - Remove the armv7 config directory from Fedora again (Justin M. Forbes) - Enable CONFIG_EXPERT for both RHEL and Fedora (Justin M. Forbes) - redhat/configs: Enable CONFIG_DEVICE_PRIVATE on aarch64 (David Hildenbrand) [2231407] - redhat/configs: disable CONFIG_ROCKCHIP_ERRATUM_3588001 for RHEL (Mark Salter) - redhat: shellcheck fixes (Prarit Bhargava) - redhat/configs: enable tegra114 SPI (Mark Salter) - all: properly cleanup firewire once and for all (Peter Robinson) - Fix up filters for Fedora (Justin M. Forbes) - New configs in arch/x86 (Fedora Kernel Team) - Add an armv7 directory back for the Fedora configs (Justin M. Forbes) - Fedora 6.5 config updates (Justin M. Forbes) - Turn off DMABUF_SYSFS_STATS (Justin M. Forbes) - CI: rawhide_release: switch to using script to push (Don Zickus) - redhat/self-test: Update self-test data (Prarit Bhargava) - redhat/scripts/cross-compile: Update download_cross.sh (Prarit Bhargava) - redhat/Makefile.cross: Remove ARCH selection code (Prarit Bhargava) - redhat/Makefile.cross: Update script (Prarit Bhargava) - Fix interruptible non MR jobs (Michael Hofmann) - all: run evaluate_configs to de-dupe merged aarch64 (Peter Robinson) - all: arm: merge the arm and arm/aarch64 (Peter Robinson) - fedora: remove ARMv7 AKA armhfp configurations (Peter Robinson) - fedora: remove ARMv7 AKA armhfp support (Peter Robinson) - redhat/configs: enable CONFIG_VIRTIO_MEM on aarch64 (David Hildenbrand) [2044155] - redhat/configs: enable CONFIG_MEMORY_HOTREMOVE aarch64 (David Hildenbrand) [2062054] - redhat: Add arm64-16k kernel flavor scaffold for 16K page-size'd AArch64 (Neal Gompa) - fedora: enable i3c on aarch64 (Peter Robinson) - redhat/configs: Remove `CONFIG_HZ_1000 is not set` for aarch64 (Enric Balletbo i Serra) - redhat/configs: turn on the framework for SPI NOR for ARM (Steve Best) - configs: add new ChromeOS UART driver (Mark Langsdorf) - configs: add new ChromeOS Human Presence Sensor (Mark Langsdorf) - redhat/configs: Enable CONFIG_NVIDIA_WMI_EC_BACKLIGHT for both Fedora and RHEL (Kate Hsuan) - redhat/configs: Texas Instruments INA3221 driver (Steve Best) - arm: i.MX: Some minor NXP i.MX cleanups (Peter Robinson) - Description: Set config for Tegra234 pinctrl driver (Joel Slebodnick) - Update RPM Scriptlet for kernel-install Changes (Jonathan Steffan) - [CI] add exit 0 to the end of CI scripts (Don Zickus) - redhat: configs: Disable CONFIG_CRYPTO_STATS since performance issue for storage (Kate Hsuan) [2227793] - Remove obsolete variable from gitlab-ci.yml (Ondrej Kinst) - redhat/configs: Move GVT-g to Fedora only (Alex Williamson) - [CI] Make sure we are on correct branch before running script (Don Zickus) - CI: ark-update-configs: sync push command and output (Don Zickus) - CI: ark-update-configs: misc changes (Don Zickus) - CI: sync ark-create-release push commands with output (Don Zickus) - CI: ark-create-release: Add a robust check if nothing changed (Don Zickus) - CI: Remove legacy tag check cruft (Don Zickus) - CI: Introduce simple environment script (Don Zickus) - redhat/configs: Disable FIREWIRE for RHEL (Prarit Bhargava) - redhat/scripts/rh-dist-git.sh: print list of uploaded files (Denys Vlasenko) - redhat/scripts/expand_srpm.sh: add missing function, robustify (Denys Vlasenko) - redhat: Enable HSR and PRP (Felix Maurer) - redhat/scripts/rh-dist-git.sh: fix outdated message and comment (Denys Vlasenko) - redhat/configs: Disable CONFIG_I8K (Prarit Bhargava) - Make sure posttrans script doesn't fail if restorecon is not installed (Daan De Meyer) - Update filters for new config items (Justin M. Forbes) - More Fedora 6.5 configs (Justin M. Forbes) - redhat/configs: disable pre-UVC cameras for RHEL on aarch64 (Dean Nelson) - redhat/configs: enable CONFIG_MEDIA_SUPPORT for RHEL on aarch64 (Dean Nelson) - move ownership of /lib/modules// to kernel-core (Thorsten Leemhuis) - Let kernel-modules-core own the files depmod generates. (Thorsten Leemhuis) - redhat: configs: Enable CONFIG_TYPEC_STUSB160X for rhel on aarch64 (Desnes Nunes) - Add filters for ptp_dfl_tod on Fedora (Justin M. Forbes) - Fedora 6.5 configs part 1 (Justin M. Forbes) - fedora: enable CONFIG_ZYNQMP_IPI_MBOX as a builtin in pending-fedora (Patrick Talbert) - fedora: arm: some minor updates (Peter Robinson) - fedora: bluetooth: enable AOSP extensions (Peter Robinson) - fedora: wifi: tweak ZYDAS WiFI config options (Peter Robinson) - scsi: sd: Add "probe_type" module parameter to allow synchronous probing (Ewan D. Milne) [2140017] - redhat/configs: allow IMA to use MOK keys (Coiby Xu) - Simplify documentation jobs (Michael Hofmann) - Auto-cancel pipelines only on MRs (Michael Hofmann) - CI: Call script directly (Don Zickus) - CI: Remove stale TAG and Makefile cruft (Don Zickus) - CI: Move os-build tracking to common area (Don Zickus) - redhat: use the eln builder for daily jobs (Patrick Talbert) - redhat: set CONFIG_XILINX_WINDOW_WATCHDOG as disabled in pending (Patrick Talbert) - Add baseline ARK/ELN pipelines (Michael Hofmann) - Simplify job rules (Michael Hofmann) - Build ELN srpm for bot changes (Michael Hofmann) - Run RH selftests for ELN (Michael Hofmann) - Simplify job templates (Michael Hofmann) - Extract rules to allow orthogonal configuration (Michael Hofmann) - Require ELN pipelines if started automatically (Michael Hofmann) - Add ARK debug pipeline (Michael Hofmann) - Extract common parts of child pipeline job (Michael Hofmann) - Move ARK pipeline variables into job template (Michael Hofmann) - Simplify ARK pipeline rules (Michael Hofmann) - Change pathfix.py to %py3_shebang_fix (Justin M. Forbes) - Turn on NET_VENDOR_QUALCOMM for Fedora to enable rmnet (Justin M. Forbes) - redhat: add intel-m10-bmc-hwmon to filter-modules singlemods list (Patrick Talbert) - fedira: enable pending-fedora CONFIG_CPUFREQ_DT_PLATDEV as a module (Patrick Talbert) - redhat: fix the 'eln BUILD_TARGET' self-test (Patrick Talbert) - redhat: update the self-test-data (Patrick Talbert) - redhat: remove trailing space in dist-dump-variables output (Patrick Talbert) - Allow ELN pipelines failures (Michael Hofmann) - Enable cs-like CI (Michael Hofmann) - Allow to auto-cancel redundant pipelines (Michael Hofmann) - Remove obsolete unused trigger variable (Michael Hofmann) - Fix linter warnings in .gitlab-ci.yml (Michael Hofmann) - config: wifi: debug options for ath11k, brcm80211 and iwlwifi (Íñigo Huguet) - redhat: allow dbgonly cross builds (Jan Stancek) - redhat/configs: Clean up x86-64 call depth tracking configs (Waiman Long) - redhat: move SND configs from pending-rhel to rhel (Patrick Talbert) - Fix up armv7 configs for Fedora (Justin M. Forbes) - redhat: Set pending-rhel x86 values for various SND configs (Patrick Talbert) - redhat: update self-test data (Patrick Talbert) - redhat: ignore SPECBPFTOOLVERSION/bpftoolversion in self-test create-data.sh (Patrick Talbert) - fedora/rhel: Move I2C_DESIGNWARE_PLATFORM, I2C_SLAVE, & GPIOLIB from pending (Patrick Talbert) - redhat/filter-modules.sh.rhel: add needed deps for intel_rapl_tpmi (Jan Stancek) - fedora: Enable CONFIG_SPI_SLAVE (Patrick Talbert) - fedora/rhel: enable I2C_DESIGNWARE_PLATFORM, I2C_SLAVE, and GPIOLIB (Patrick Talbert) - fedora: Enable CONFIG_SPI_SLAVE in fedora-pending (Patrick Talbert) - redhat: remove extra + (plus) from meta package Requires definitions (Patrick Talbert) - Add intel-m10-bmc-hwmon to singlemods (Thorsten Leemhuis) - Add hid-uclogic-test to mod-internal.list (Thorsten Leemhuis) - Add checksum_kunit.ko to mod-internal.list (Thorsten Leemhuis) - Add strcat_kunit to mod-internal.list (Thorsten Leemhuis) - Add input_test to mod-intenal.list (Thorsten Leemhuis) - Revert "Remove EXPERT from ARCH_FORCE_MAX_ORDER for aarch64" (Justin M. Forbes) - Fix up rebase issue with CONFIG_ARCH_FORCE_MAX_ORDER (Justin M. Forbes) - redhat/kernel.spec.template: Disable 'extracting debug info' messages (Prarit Bhargava) - kernel/rh_messages.c: Another gcc12 warning on redundant NULL test (Florian Weimer) [2216678] - redhat: fix signing for realtime and arm64_64k non-debug variants (Jan Stancek) - redhat: treat with_up consistently (Jan Stancek) - redhat: make with_realtime opt-in (Jan Stancek) - redhat/configs: Disable qcom armv7 drippings in the aarch64 tree (Jeremy Linton) - kernel.spec: drop obsolete ldconfig (Jan Stancek) - Consolidate config items to common for 6.4 cycle (Justin M. Forbes) - Turn on CO?NFIg_RMNET for Fedora (Justin M. Forbes) - redhat/configs: enable CONFIG_MANA_INFINIBAND=m for ARK (Vitaly Kuznetsov) - redhat/config: common: Enable CONFIG_GPIO_SIM for software development (Kate Hsuan) - redhat: fix problem with RT kvm modules listed twice in rpm generation (Clark Williams) - redhat: turn off 64k kernel builds with rtonly (Clark Williams) - redhat: turn off zfcpdump for rtonly (Clark Williams) - redhat: don't allow with_rtonly to turn on unsupported arches (Clark Williams) - redhat: update self-test data for addition of RT and 64k-page variants (Clark Williams) - redhat: fix realtime and efiuki build conflict (Jan Stancek) - arm64-64k: Add new kernel variant to RHEL9/CS9 for 64K page-size'd ARM64 (Donald Dutile) [2153073] - redhat: TEMPORARY set configs to deal with PREEMPT_RT not available (Clark Williams) - redhat: TEMPORARY default realtime to off (Clark Williams) - redhat: moved ARM errata configs to arm dir (Clark Williams) - redhat: RT packaging changes (Clark Williams) - redhat: miscellaneous commits needed due to CONFIG_EXPERT (Clark Williams) - redhat: realtime config entries (Clark Williams) - common: remove deleted USB PCCARD drivers (Peter Robinson) - fedora: further cleanup of pccard/cardbus subsystem (Peter Robinson) - common: properly disable PCCARD subsystem (Peter Robinson) - redhat/configs: arm: enable SERIAL_TEGRA UART for RHEL (Mark Salter) - redhat/configs: enable CONFIG_X86_AMD_PSTATE_UT (David Arcari) - redhat/configs: Enable CONFIG_TCG_VTPM_PROXY for RHEL (Štěpán Horáček) - redhat: do not package *.mod.c generated files (Denys Vlasenko) - ALSA configuration changes for ARK/RHEL 9.3 (Jaroslav Kysela) - spec: remove resolve_btfids from kernel-devel (Viktor Malik) - Fix typo in filter-modules (Justin M. Forbes) - redhat/configs: Enable CONFIG_INIT_STACK_ALL_ZERO for RHEL (Josh Poimboeuf) - Remove CONFIG_ARCH_FORCE_MAX_ORDER for aarch64 (Justin M. Forbes) - Fix up config and filter for PTP_DFL_TOD (Justin M. Forbes) - redhat/configs: IMX8ULP pinctrl driver (Steve Best) - redhat/configs: increase CONFIG_FRAME_WARN for Fedora on aarch64 (Brian Masney) - redhat/configs: add two missing Kconfig options for the Thinkpad x13s (Brian Masney) - Fedora configs for 6.4 (Justin M. Forbes) - Change aarch64 CONFIG_ARCH_FORCE_MAX_ORDER to 10 for 4K pages (Justin M. Forbes) - kernel.spec: remove "RPM_VMLINUX_H=$DevelDir/vmlinux.h" code chunk in %install (Denys Vlasenko) - redhat/configs: aarch64: Turn on Display for OnePlus 6 (Eric Curtin) - redhat/configs: NXP i.MX93 pinctrl, clk, analog to digital converters (Steve Best) - redhat/configs: Enable CONFIG_SC_GPUCC_8280XP for fedora (Andrew Halaney) - redhat/configs: Enable CONFIG_QCOM_IPCC for fedora (Andrew Halaney) - Add rv subpackage for kernel-tools (John Kacur) [2188441] - redhat/configs: NXP i.MX9 family (Steve Best) - redhat/genlog.py: add support to list/process zstream Jira tickets (Herton R. Krzesinski) - redhat: fix duplicate jira issues in the resolves line (Herton R. Krzesinski) - redhat: add support for Jira issues in changelog (Herton R. Krzesinski) - redhat/configs: turn on IMX8ULP CCM Clock Driver (Steve Best) - redhat: update filter-modules fsdrvs list to reference smb instead of cifs (Patrick Talbert) - Turn off some debug options found to impact performance (Justin M. Forbes) - wifi: rtw89: enable RTL8852BE card in RHEL (Íñigo Huguet) - redhat/configs: enable TEGRA186_GPC_DMA for RHEL (Mark Salter) - Move imx8m configs from fedora to common (Mark Salter) - redhat/configs: turn on lpuart serial port support Driver (Steve Best) [2208834] - Turn off DEBUG_VM for non debug Fedora kernels (Justin M. Forbes) - Enable CONFIG_BT on aarch64 (Charles Mirabile) - redhat/configs: turn on CONFIG_MARVELL_CN10K_TAD_PMU (Michal Schmidt) [2042240] - redhat/configs: Fix enabling MANA Infiniband (Kamal Heib) - Fix file listing for symvers in uki (Justin M. Forbes) - Fix up some Fedora config items (Justin M. Forbes) - enable efifb for Nvidia (Justin M. Forbes) - kernel.spec: package unstripped test_progs-no_alu32 (Felix Maurer) - Turn on NFT_CONNLIMIT for Fedora (Justin M. Forbes) - Include the information about builtin symbols into kernel-uki-virt package too (Vitaly Kuznetsov) - redhat/configs: Fix incorrect configs location and content (Vladis Dronov) - redhat/configs: turn on CONFIG_MARVELL_CN10K_DDR_PMU (Michal Schmidt) [2042241] - redhat: configs: generic: x86: Disable CONFIG_VIDEO_OV2740 for x86 platform (Kate Hsuan) - Enable IO_URING for RHEL (Justin M. Forbes) - Turn on IO_URING for RHEL in pending (Justin M. Forbes) - redhat: Remove editconfig (Prarit Bhargava) - redhat: configs: fix CONFIG_WERROR replace in build_configs (Jan Stancek) - redhat/configs: enable Maxim MAX77620 PMIC for RHEL (Mark Salter) - kernel.spec: skip kernel meta package when building without up (Jan Stancek) - redhat/configs: enable RDMA_RXE for RHEL (Kamal Heib) [2022578] - redhat/configs: update RPCSEC_GSS_KRB5 configs (Scott Mayhew) - redhat/Makefile: Support building linux-next (Thorsten Leemhuis) - redhat/Makefile: support building stable-rc versions (Thorsten Leemhuis) - redhat/Makefile: Add target to print DISTRELEASETAG (Thorsten Leemhuis) - Remove EXPERT from ARCH_FORCE_MAX_ORDER for aarch64 (Justin M. Forbes) - Revert "Merge branch 'unstripped-no_alu32' into 'os-build'" (Patrick Talbert) - configs: Enable CONFIG_PAGE_POOL_STATS for common/generic (Patrick Talbert) - redhat/configs: enable CONFIG_DELL_WMI_PRIVACY for both RHEL and Fedora (David Arcari) - kernel.spec: package unstripped test_progs-no_alu32 (Felix Maurer) - bpf/selftests: fix bpf selftests install (Jerome Marchand) - kernel.spec: add bonding selftest (Hangbin Liu) - Change FORCE_MAX_ORDER for ppc64 to be 8 (Justin M. Forbes) - kernel.spec.template: Add global compression variables (Prarit Bhargava) - kernel.spec.template: Use xz for KABI (Prarit Bhargava) - kernel.spec.template: Remove gzip related aarch64 code (Prarit Bhargava) - Add apple_bl to filter-modules (Justin M. Forbes) - Add handshake-test to mod-intenal.list (Justin M. Forbes) - Add regmap-kunit to mod-internal.list (Justin M. Forbes) - configs: set CONFIG_PAGE_POOL_STATS (Patrick Talbert) - Add apple_bl to fedora module_filter (Justin M. Forbes) - Fix up some config mismatches in new Fedora config items (Justin M. Forbes) - redhat/configs: disable CONFIG_USB_NET_SR9700 for aarch64 (Jose Ignacio Tornos Martinez) - Fix up the RHEL configs for xtables and ipset (Justin M. Forbes) - ark: enable wifi on aarch64 (Íñigo Huguet) - fedora: wifi: hermes: disable 802.11b driver (Peter Robinson) - fedora: wifi: libertas: use the LIBERTAS_THINFIRM driver (Peter Robinson) - fedora: wifi: disable Zydas vendor (Peter Robinson) - redhat: fix python ValueError in error path of merge.py (Clark Williams) - fedora: arm: minor updates (Peter Robinson) - kernel.spec: Fix UKI naming to comply with BLS (Philipp Rudo) - redhat/kernel.spec.template: Suppress 'extracting debug info' noise in build log (Prarit Bhargava) - Fedora 6.3 configs part 2 (Justin M. Forbes) - redhat/configs: Enable CONFIG_X86_KERNEL_IBT for Fedora and ARK (Josh Poimboeuf) - kernel.spec: gcov: make gcov subpackages per variant (Jan Stancek) - kernel.spec: Gemini: add Epoch to perf and rtla subpackages (Jan Stancek) - kernel.spec: Gemini: fix header provides for upgrade path (Jan Stancek) - redhat: introduce Gemini versioning (Jan Stancek) - redhat: separate RPM version from uname version (Jan Stancek) - redhat: introduce GEMINI and RHEL_REBASE_NUM variable (Jan Stancek) - ipmi: ssif_bmc: Add SSIF BMC driver (Tony Camuso) - common: minor de-dupe of parallel port configs (Peter Robinson) - Fedora 6.3 configs part 1 (Justin M. Forbes) - redhat: configs: Enable CONFIG_MEMTEST to enable memory test (Kate Hsuan) - Update Fedora arm filters after config updates (Nicolas Chauvet) - redhat/kernel.spec.template: Fix kernel-tools-libs-devel dependency (Prarit Bhargava) - redhat: fix the check for the n option (Patrick Talbert) - common: de-dupe some options that are the same (Peter Robinson) - generic: remove deleted options (Peter Robinson) - redhat/configs: enable CONFIG_INTEL_TCC_COOLING for RHEL (David Arcari) - Update Fedora ppc filters after config updates (Justin M. Forbes) - Update Fedora aarch64 filters after config updates (Justin M. Forbes) - fedora: arm: Updates for 6.3 (Peter Robinson) - redhat: kunit: cleanup NITRO config and enable rescale test (Nico Pache) - kernel.spec: use %{package_name} to fix kernel-devel-matched Requires (Jan Stancek) - kernel.spec: use %{package_name} also for abi-stablelist subpackages (Jan Stancek) - kernel.spec: use %{package_name} also for tools subpackages (Jan Stancek) - generic: common: Parport and paride/ata cleanups (Peter Robinson) - CONFIG_SND_SOC_CS42L83 is no longer common (Justin M. Forbes) - configs: arm: bring some configs in line with rhel configs in c9s (Mark Salter) - arm64/configs: Put some arm64 configs in the right place (Mark Salter) - cleanup removed R8188EU config (Peter Robinson) - Make RHJOBS container friendly (Don Zickus) - Remove scmversion from kernel.spec.template (Don Zickus) - redhat/configs: Enable CONFIG_SND_SOC_CS42L83 (Neal Gompa) - Use RHJOBS for create-tarball (Don Zickus) - Enable CONFIG_NET_SCH_FQ_PIE for Fedora (Justin M. Forbes) - Make Fedora debug configs more useful for debug (Justin M. Forbes) - redhat/configs: enable Octeon TX2 network drivers for RHEL (Michal Schmidt) [2040643] - redhat/kernel.spec.template: fix installonlypkg for meta package (Jan Stancek) - redhat: version two of Makefile.rhelver tweaks (Clark Williams) - redhat/configs: Disable CONFIG_GCC_PLUGINS (Prarit Bhargava) - redhat/kernel.spec.template: Fix typo for process_configs.sh call (Neal Gompa) - redhat/configs: CONFIG_CRYPTO_SM3_AVX_X86_64 is x86 only (Vladis Dronov) - redhat/configs: Enable CONFIG_PINCTRL_METEORLAKE in RHEL (Prarit Bhargava) - fedora: enable new image sensors (Peter Robinson) - redhat/self-test: Update self-test data (Prarit Bhargava) - redhat/kernel.spec.template: Fix hardcoded "kernel" (Prarit Bhargava) - redhat/configs/generate_all_configs.sh: Fix config naming (Prarit Bhargava) - redhat/kernel.spec.template: Pass SPECPACKAGE_NAME to generate_all_configs.sh (Prarit Bhargava) - kernel.spec.template: Use SPECPACKAGE_NAME (Prarit Bhargava) - redhat/Makefile: Copy spec file (Prarit Bhargava) - redhat: Change PACKAGE_NAME to SPECPACKAGE_NAME (Prarit Bhargava) - redhat/configs: Support the virtio_mmio.device parameter in Fedora (David Michael) - Revert "Merge branch 'systemd-boot-unsigned' into 'os-build'" (Patrick Talbert) - redhat/Makefile: fix default values for dist-brew's DISTRO and DIST (Íñigo Huguet) - Remove cc lines from automatic configs (Don Zickus) - Add rtla-hwnoise files (Justin M. Forbes) - redhat/kernel.spec.template: Mark it as a non-executable file (Neal Gompa) - fedora: arm: Enable DRM_PANEL_HIMAX_HX8394 (Javier Martinez Canillas) - redhat/configs: CONFIG_HP_ILO location fix (Vladis Dronov) - redhat: Fix build for kselftests mm (Nico Pache) - fix tools build after vm to mm rename (Justin M. Forbes) - redhat/spec: Update bpftool versioning scheme (Viktor Malik) - redhat/configs: CONFIG_CRYPTO_SM4_AESNI_AVX*_X86_64 is x86 only (Prarit Bhargava) - redhat: adapt to upstream Makefile change (Clark Williams) - redhat: modify efiuki specfile changes to use variants convention (Clark Williams) - Turn off DEBUG_INFO_COMPRESSED_ZLIB for Fedora (Justin M. Forbes) - redhat/kernel.spec.template: Fix RHEL systemd-boot-unsigned dependency (Prarit Bhargava) - Add hashtable_test to mod-internal.list (Justin M. Forbes) - Add more kunit tests to mod-internal.list for 6.3 (Justin M. Forbes) - Flip CONFIG_I2C_ALGOBIT to m (Justin M. Forbes) - Flip I2C_ALGOBIT to m to avoid mismatch (Justin M. Forbes) - kernel.spec: move modules.builtin to kernel-core (Jan Stancek) - Turn on IDLE_INJECT for x86 (Justin M. Forbes) - Flip CONFIG_IDLE_INJECT in pending (Justin M. Forbes) - redhat/configs: Enable CONFIG_V4L_TEST_DRIVERS related drivers (Enric Balletbo i Serra) - redhat/configs: Enable UCSI_CCG support (David Marlin) - Fix underline mark-up after text change (Justin M. Forbes) - Turn on CONFIG_XFS_RT for Fedora (Justin M. Forbes) - Consolidate common configs for 6.2 (Justin M. Forbes) - aarch64: enable zboot (Gerd Hoffmann) - redhat: remove duplicate pending-rhel config items (Patrick Talbert) - Disable frame pointers (Justin M. Forbes) - redhat/configs: update scripts and docs for ark -> rhel rename (Clark Williams) - redhat/configs: rename ark configs dir to rhel (Clark Williams) - Turn off CONFIG_DEBUG_INFO_COMPRESSED_ZLIB for ppc64le (Justin M. Forbes) - kernel.spec: package unstripped kselftests/bpf/test_progs (Jan Stancek) - kernel.spec: allow to package some binaries as unstripped (Jan Stancek) - redhat/configs: Make merge.py portable for older python (Desnes Nunes) - Fedora configs for 6.2 (Justin M. Forbes) - redhat: Repair ELN build broken by the recent UKI changes (Vitaly Kuznetsov) - redhat/configs: enable CONFIG_INET_DIAG_DESTROY (Andrea Claudi) - Enable TDX Guest driver (Vitaly Kuznetsov) - redhat/configs: Enable CONFIG_PCIE_PTM generically (Corinna Vinschen) - redhat: Add sub-RPM with a EFI unified kernel image for virtual machines (Vitaly Kuznetsov) - redhat/Makefile: Remove GIT deprecated message (Prarit Bhargava) - Revert "redhat: configs: Disable xtables and ipset" (Phil Sutter) - redhat/configs: Enable CONFIG_SENSORS_LM90 for RHEL (Mark Salter) - Fix up SQUASHFS decompression configs (Justin M. Forbes) - redhat/configs: enable CONFIG_OCTEON_EP as a module in ARK (Michal Schmidt) [2041990] - redhat: ignore rpminspect runpath report on urandom_read selftest binaries (Herton R. Krzesinski) - kernel.spec: add llvm-devel build requirement (Scott Weaver) - Update self-test data to not expect debugbuildsenabled 0 (Justin M. Forbes) - Turn off forced debug builds (Justin M. Forbes) - Turn on debug builds for aarch64 Fedora (Justin M. Forbes) - redhat/configs: modify merge.py to match old overrides input (Clark Williams) - redhat: fixup pylint complaints (Clark Williams) - redhat: remove merge.pl and references to it (Clark Williams) - redhat: update merge.py to handle merge.pl corner cases (Clark Williams) - Revert "redhat: fix elf got hardening for vm tools" (Don Zickus) - Update rebase notes for Fedora (Justin M. Forbes) - Update CONFIG_LOCKDEP_CHAINS_BITS to 19 (cmurf) - redhat/configs: Turn on CONFIG_SPI_TEGRA210_QUAD for RHEL (Mark Salter) - ark: aarch64: drop CONFIG_SMC911X (Peter Robinson) - all: cleanup and de-dupe CDROM_PKTCDVD options. (Peter Robinson) - all: remove CRYPTO_GF128MUL (Peter Robinson) - all: cleanup UEFI options (Peter Robinson) - common: arm64: Enable Ampere Altra SMpro Hardware Monitoring (Peter Robinson) - fedora: enable STACKPROTECTOR_STRONG (Peter Robinson) - fedora: enable STACKPROTECTOR on arm platforms (Peter Robinson) - redhat/self-test: Update data with ENABLE_WERROR (Prarit Bhargava) - redhat/Makefile.variables: Add ENABLE_WERROR (Prarit Bhargava) - makefile: Add -Werror support for RHEL (Prarit Bhargava) - redhat/Makefile.variables: Remove mention of Makefile.rhpkg (Prarit Bhargava) - redhat/Makefile.variables: Alphabetize variables (Prarit Bhargava) - gitlab-ci: use CI templates from production branch (Michael Hofmann) - redhat/kernel.spec.template: Fix internal "File listed twice" errors (Prarit Bhargava) - redhat: Remove stale .tmp_versions code and comments (Prarit Bhargava) - redhat/kernel.spec.template: Fix vmlinux_decompressor on !s390x (Prarit Bhargava) - redhat/kernel.spec.template: Remove unnecessary output from pathfix.py (Prarit Bhargava) - Modularize CONFIG_ARM_CORESIGHT_PMU_ARCH_SYSTEM_PMU (Mark Salter) - redhat/kernel.spec.template: Parallelize compression (Prarit Bhargava) - config: Enable Security Path (Ricardo Robaina) - redhat/self-test/data: Regenerate self-test data for make change (Prarit Bhargava) - Update module filters for nvmem_u-boot-env (Justin M. Forbes) - fedora: Updates for 6.2 merge (Peter Robinson) - fedora: Updates for 6.1 merge (Peter Robinson) - modules-core: use %posttrans (Gerd Hoffmann) - split sub-rpm kernel-modules-core from kernel-core (Gerd Hoffmann) - Turn off CONFIG_MTK_T7XX for S390x (Justin M. Forbes) - CI: add variable for variant handling (Veronika Kabatova) - Fix up configs with SND_SOC_NAU8315 mismatch (Justin M. Forbes) - CI: Do a full build for non-bot runs (Veronika Kabatova) - Fix up configs with SND_SOC_NAU8315 mismatch (Justin M. Forbes) - kernel/rh_messages.c: gcc12 warning on redundant NULL test (Eric Chanudet) [2142658] - redhat/configs: Enable CRYPTO_CURVE25519 in ark (Prarit Bhargava) - general: arm: cleanup ASPEED options (Peter Robinson) - redhat/configs: ALSA - cleanups for the AMD Pink Sardine DMIC driver (Jaroslav Kysela) - redhat/docs: Add FAQ entry for booting between Fedora & ELN/RHEL kernels (Prarit Bhargava) - spec: add missing BuildRequires: python3-docutils for tools (Ondrej Mosnacek) - config: enable RCU_TRACE for debug kernels (Wander Lairson Costa) - Add siphash_kunit and strscpy_kunit to mod-internal.list (Justin M. Forbes) - Add drm_kunit_helpers to mod-internal.list (Justin M. Forbes) - Fix up configs for Fedora so we don't have a mismatch (Justin M. Forbes) - Turn on CONFIG_SQUASHFS_DECOMP_SINGLE in pending (Justin M. Forbes) - redhat/kernel.spec.template: Fix cpupower file error (Prarit Bhargava) - redhat/configs: aarhc64: clean up some erratum configs (Mark Salter) - More Fedora configs for 6.1 as deps were switched on (Justin M. Forbes) - redhat/configs: make SOC_TEGRA_CBB a module (Mark Salter) - redhat/configs: aarch64: reorganize tegra configs to common dir (Mark Salter) - Enforces buildroot if cross_arm (Nicolas Chauvet) - Handle automated case when config generation works correctly (Don Zickus) - Turn off CONFIG_CRYPTO_ARIA_AESNI_AVX_X86_64 (Justin M. Forbes) - Turn off CONFIG_EFI_ZBOOT as it makes CKI choke (Justin M. Forbes) - Fedora config updates for 6.1 (Justin M. Forbes) - redhat: Remove cpupower files (Prarit Bhargava) - redhat/configs: update CXL-related options to match what RHEL will use (John W. Linville) - Clean up the config for the Tegra186 timer (Al Stone) - redhat/configs: move CONFIG_TEGRA186_GPC_DMA config (Mark Salter) - Check for kernel config git-push failures (Don Zickus) - redhat: genlog.sh failures should interrupt the recipe (Patrick Talbert) - Turn CONFIG_GNSS back on for Fedora (Justin M. Forbes) - redhat/configs: enable CONFIG_GNSS for RHEL (Michal Schmidt) - Turn off NVMEM_U_BOOT_ENV for fedora (Justin M. Forbes) - Consolidate matching fedora and ark entries to common (Justin M. Forbes) - Empty out redhat/configs/common (Justin M. Forbes) - Adjust path to compressed vmlinux kernel image for s390x (Justin M. Forbes) [2149273] - Fedora config updates for 6.1 (Justin M. Forbes) - redhat: genlog.sh should expect genlog.py in the current directory (Patrick Talbert) - redhat/configs: consolidate CONFIG_TEST_LIVEPATCH=m (Joe Lawrence) - redhat/configs: enable CONFIG_TEST_LIVEPATCH=m for s390x (Julia Denham) - Revert "Merge branch 'ark-make-help' into 'os-build'" (Scott Weaver) - Remove recommendation to use 'common' for config changes. (Don Zickus) - Update config to add i3c support for AArch64 (Mark Charlebois) - redhat: Move cross-compile scripts into their own directory (Prarit Bhargava) - redhat: Move yaml files into their own directory (Prarit Bhargava) - redhat: Move update_scripts.sh into redhat/scripts (Prarit Bhargava) - redhat: Move kernel-tools scripts into their own directory (Prarit Bhargava) - redhat: Move gen-* scripts into their own directory (Prarit Bhargava) - redhat: Move mod-* scripts into their own directory (Prarit Bhargava) - redhat/Makefile: Fix RHJOBS grep warning (Prarit Bhargava) - redhat: Force remove tmp file (Prarit Bhargava) - redhat/configs: ALSA - cleanups for the CentOS 9.2 update (Jaroslav Kysela) - CI: Use CKI container images from quay.io (Veronika Kabatova) - redhat: clean up the partial-kgcov-snip.config file (Patrick Talbert) - redhat: avoid picking up stray editor backups when processing configs (Clark Williams) - CI: Remove old configs (Veronika Kabatova) - redhat: override `make help` to include dist-help (Jonathan Toppins) - redhat: make RHTEST stricter (Jonathan Toppins) - redhat: Enable support for SN2201 system (Ivan Vecera) - redhat/docs/index.rst: Add FLAVOR information to generate configs for local builds (Enric Balletbo i Serra) - redhat: fix selftest git command so it picks the right commit (Patrick Talbert) - redhat/configs: enable HP_WATCHDOG for aarch64 (Mark Salter) - redhat: disable Kfence Kunit Test (Nico Pache) - configs: enable CONFIG_LRU_GEN_ENABLED everywhere (Patrick Talbert) - redhat: Enable WWAN feature and support for Intel, Qualcomm and Mediatek devices (Jose Ignacio Tornos Martinez) - Turn on dln2 support (RHBZ 2110372) (Justin M. Forbes) - Enable configs for imx8m PHYs (Al Stone) - configs/fedora: Build some SC7180 clock controllers as modules (Javier Martinez Canillas) - redhat/configs: Disable fbdev drivers and use simpledrm everywhere (Javier Martinez Canillas) [1986223] - redhat: fix the branch we pull from the documentation tree (Herton R. Krzesinski) - redhat/configs: change so watchdog is module versus builtin (Steve Best) - redhat/configs: move CONFIG_ACPI_VIDEO to common/generic (Mark Langsdorf) - enable imx8xm I2C configs properly (Al Stone) - configs/fedora: Enable a few more drivers needed by the HP X2 Chromebook (Javier Martinez Canillas) - enable the rtc-rv8803 driver on RHEL and Fedora (David Arcari) - redhat/Makefile: Remove BUILD_SCRATCH_TARGET (Prarit Bhargava) - configs: move CONFIG_INTEL_TDX_GUEST to common directory (Wander Lairson Costa) - redhat/Makefile: Use new BUILD_TARGET for RHEL dist[g]-brew target (Prarit Bhargava) - redhat: method.py: change the output loop to use 'values' method (Patrick Talbert) - redhat: use 'update' method in merge.py (Patrick Talbert) - redhat: Use a context manager in merge.py for opening the config file for reading (Patrick Talbert) - redhat: automatically strip newlines in merge.py (Clark Williams) - redhat: python replacement for merge.pl (Clark Williams) - redhat/docs: Update with DISTLOCALVERSION (Prarit Bhargava) - redhat/Makefile: Rename LOCALVERSION to DISTLOCALVERSION (Akihiko Odaki) - Adjust FIPS module name in RHEL (Vladis Dronov) - spec: prevent git apply from searching for the .git directory (Ondrej Mosnacek) - redhat: Remove parallel_xz.sh (Prarit Bhargava) - Turn on Multi-Gen LRU for Fedora (Justin M. Forbes) - Add kasan_test to mod-internal.list (Justin M. Forbes) - redhat/Makefile.variables: Fix typo with RHDISTGIT_TMP (Prarit Bhargava) - spec: fix path to `installing_core` stamp file for subpackages (Jonathan Lebon) - Remove unused ci scripts (Don Zickus) - Rename rename FORCE_MAX_ZONEORDER to ARCH_FORCE_MAX_ORDER in configs (Justin M. Forbes) - redhat: Add new fortify_kunit & is_signed_type_kunit to mod-internal.list (Patrick Talbert) - Rename rename FORCE_MAX_ZONEORDER to ARCH_FORCE_MAX_ORDER in pending (Justin M. Forbes) - Add acpi video to the filter_modules.sh for rhel (Justin M. Forbes) - Change acpi_bus_get_acpi_device to acpi_get_acpi_dev (Justin M. Forbes) - Turn on ACPI_VIDEO for arm (Justin M. Forbes) - Turn on CONFIG_PRIME_NUMBERS as a module (Justin M. Forbes) - Add new drm kunit tests to mod-internal.list (Justin M. Forbes) - redhat: fix elf got hardening for vm tools (Frantisek Hrbata) - kernel.spec.template: remove some temporary files early (Ondrej Mosnacek) - kernel.spec.template: avoid keeping two copies of vmlinux (Ondrej Mosnacek) - Add fortify_kunit to mod-internal.list (Justin M. Forbes) - Add module filters for Fedora as acpi video has new deps (Justin M. Forbes) - One more mismatch (Justin M. Forbes) - Fix up pending for mismatches (Justin M. Forbes) - Forgot too remove this from pending, it is set properly in ark (Justin M. Forbes) - redhat/Makefile: Add DIST to git tags for RHEL (Prarit Bhargava) - redhat/configs: Move CONFIG_ARM_SMMU_QCOM_DEBUG to common (Jerry Snitselaar) - Common config cleanup for 6.0 (Justin M. Forbes) - Allow selftests to fail without killing the build (Justin M. Forbes) - redhat: Remove redhat/Makefile.rhpkg (Prarit Bhargava) - redhat/Makefile: Move RHDISTGIT_CACHE and RHDISTGIT_TMP (Prarit Bhargava) - redhat/Makefile.rhpkg: Remove RHDISTGIT_USER (Prarit Bhargava) - redhat/Makefile: Move RHPKG_BIN to redhat/Makefile (Prarit Bhargava) - common: clean up Android option with removal of CONFIG_ANDROID (Peter Robinson) - redhat/configs: Remove x86_64 from priority files (Prarit Bhargava) - redhat/configs/pending-ark: Remove x86_64 directory (Prarit Bhargava) - redhat/configs/pending-fedora: Remove x86_64 directory (Prarit Bhargava) - redhat/configs/fedora: Remove x86_64 directory (Prarit Bhargava) - redhat/configs/common: Remove x86_64 directory (Prarit Bhargava) - redhat/configs/ark: Remove x86_64 directory (Prarit Bhargava) - redhat/configs/custom-overrides: Remove x86_64 directory (Prarit Bhargava) - configs: use common CONFIG_ARM64_SME for ark and fedora (Mark Salter) - redhat/configs: Add a warning message to priority.common (Prarit Bhargava) - redhat/configs: Enable INIT_STACK_ALL_ZERO for Fedora (Miko Larsson) - redhat: Set CONFIG_MAXLINEAR_GPHY to =m (Petr Oros) - redhat/configs enable CONFIG_INTEL_IFS (David Arcari) - redhat: Remove filter-i686.sh.rhel (Prarit Bhargava) - redhat/Makefile: Set PATCHLIST_URL to none for RHEL/cs9 (Prarit Bhargava) - redhat: remove GL_DISTGIT_USER, RHDISTGIT and unify dist-git cloning (Prarit Bhargava) - redhat/Makefile.variables: Add ADD_COMMITID_TO_VERSION (Prarit Bhargava) - kernel.spec: disable vmlinux.h generation for s390 zfcpdump config (Prarit Bhargava) - perf: Require libbpf 0.6.0 or newer (Prarit Bhargava) - kabi: add stablelist helpers (Prarit Bhargava) - Makefile: add kabi targets (Prarit Bhargava) - kabi: add support for symbol namespaces into check-kabi (Prarit Bhargava) - kabi: ignore new stablelist metadata in show-kabi (Prarit Bhargava) - redhat/Makefile: add dist-assert-tree-clean target (Prarit Bhargava) - redhat/kernel.spec.template: Specify vmlinux.h path when building samples/bpf (Prarit Bhargava) [2041365] - spec: Fix separate tools build (Prarit Bhargava) [2054579] - redhat/scripts: Update merge-subtrees.sh with new subtree location (Prarit Bhargava) - redhat/kernel.spec.template: enable dependencies generation (Prarit Bhargava) - redhat: build and include memfd to kernel-selftests-internal (Prarit Bhargava) [2027506] - redhat/kernel.spec.template: Link perf with --export-dynamic (Prarit Bhargava) - redhat: kernel.spec: selftests: abort on build failure (Prarit Bhargava) - redhat: configs: move CONFIG_SERIAL_MULTI_INSTANTIATE=m settings to common/x86 (Jaroslav Kysela) - configs: enable CONFIG_HP_ILO for aarch64 (Mark Salter) - all: cleanup dell config options (Peter Robinson) - redhat: Include more kunit tests (Nico Pache) - common: some minor cleanups/de-dupe (Peter Robinson) - common: enable INTEGRITY_MACHINE_KEYRING on all configuraitons (Peter Robinson) - Fedora 6.0 configs update (Justin M. Forbes) - redhat/self-test: Ignore .rhpkg.mk files (Prarit Bhargava) - redhat/configs: Enable CONFIG_PRINTK_INDEX on Fedora (Prarit Bhargava) - redhat/configs: Cleanup CONFIG_X86_KERNEL_IBT (Prarit Bhargava) - Fix up SND_CTL debug options (Justin M. Forbes) - redhat: create /boot symvers link if it doesn't exist (Jan Stancek) - redhat: remove duplicate kunit tests in mod-internal.list (Nico Pache) - configs/fedora: Make Fedora work with HNS3 network adapter (Zamir SUN) - redhat/configs/fedora/generic: Enable CONFIG_BLK_DEV_UBLK on Fedora (Richard W.M. Jones) [2122595] - fedora: disable IWLMEI (Peter Robinson) - redhat/configs: enable UINPUT on aarch64 (Benjamin Tissoires) - Fedora 6.0 configs part 1 (Justin M. Forbes) - redhat/Makefile: Always set UPSTREAM (Prarit Bhargava) - redhat/configs: aarch64: Turn on Apple Silicon configs for Fedora (Eric Curtin) - Add cpumask_kunit to mod-internal.list (Justin M. Forbes) - config - consolidate disabled MARCH options on s390x (Dan Horák) - move the baseline arch to z13 for s390x in F-37+ (Dan Horák) - redhat/scripts/rh-dist-git.sh: Fix outdated cvs reference (Prarit Bhargava) - redhat/scripts/expand_srpm.sh: Use Makefile variables (Prarit Bhargava) - redhat/scripts/clone_tree.sh: Use Makefile variables (Prarit Bhargava) - Fedora: arm changes for 6.0, part 1, with some ACPI (Peter Robinson) - redhat/self-test: Fix shellcheck errors (Prarit Bhargava) - redhat/docs: Add dist-brew BUILD_FLAGS information (Prarit Bhargava) - redhat: change the changelog item for upstream merges (Herton R. Krzesinski) - redhat: fix dist-release build number test (Herton R. Krzesinski) - redhat: fix release number bump when dist-release-changed runs (Herton R. Krzesinski) - redhat: use new genlog.sh script to detect changes for dist-release (Herton R. Krzesinski) - redhat: move changelog addition to the spec file back into genspec.sh (Herton R. Krzesinski) - redhat: always add a rebase entry when ark merges from upstream (Herton R. Krzesinski) - redhat: drop merge ark patches hack (Herton R. Krzesinski) - redhat: don't hardcode temporary changelog file (Herton R. Krzesinski) - redhat: split changelog generation from genspec.sh (Herton R. Krzesinski) - redhat: configs: Disable FIE on arm (Jeremy Linton) [2012226] - redhat/Makefile: Clean linux tarballs (Prarit Bhargava) - redhat/configs: Cleanup CONFIG_ACPI_AGDI (Prarit Bhargava) - spec: add cpupower daemon reload on install/upgrade (Jarod Wilson) - redhat: properly handle binary files in patches (Ondrej Mosnacek) - Add python3-setuptools buildreq for perf (Justin M. Forbes) - Add cros_kunit to mod-internal.list (Justin M. Forbes) - Add new tests to mod-internal.list (Justin M. Forbes) - Turn off some Kunit tests in pending (Justin M. Forbes) - Clean up a mismatch in Fedora configs (Justin M. Forbes) - redhat/configs: Sync up Retbleed configs with centos-stream (Waiman Long) - Change CRYPTO_BLAKE2S_X86 from m to y (Justin M. Forbes) - Leave CONFIG_ACPI_VIDEO on for x86 only (Justin M. Forbes) - Fix BLAKE2S_ARM and BLAKE2S_X86 configs in pending (Justin M. Forbes) - Fix pending for ACPI_VIDEO (Justin M. Forbes) - redhat/configs: Fix rm warning on config warnings (Eric Chanudet) - redhat/Makefile: Deprecate PREBUILD_GIT_ONLY variable (Prarit Bhargava) - redhat/Makefile: Deprecate SINGLE_TARBALL variable (Prarit Bhargava) - redhat/Makefile: Deprecate GIT variable (Prarit Bhargava) - Update CONFIG_LOCKDEP_CHAINS_BITS to 18 (cmurf) - Add new FIPS module name and version configs (Vladis Dronov) - redhat/configs/fedora: Make PowerPC's nx-gzip buildin (Jakub Čajka) - omit unused Provides (Dan Horák) - self-test: Add test for DIST=".eln" (Prarit Bhargava) - redhat: Enable CONFIG_LZ4_COMPRESS on Fedora (Prarit Bhargava) - fedora: armv7: enable MMC_STM32_SDMMC (Peter Robinson) - .gitlab-ci.yaml: Add test for dist-get-buildreqs target (Prarit Bhargava) - redhat/docs: Add information on build dependencies (Prarit Bhargava) - redhat/Makefile: Add better pass message for dist-get-buildreqs (Prarit Bhargava) - redhat/Makefile: Provide a better message for system-sb-certs (Prarit Bhargava) - redhat/Makefile: Change dist-buildreq-check to a non-blocking target (Prarit Bhargava) - create-data: Parallelize spec file data (Prarit Bhargava) - create-data.sh: Store SOURCES Makefile variable (Prarit Bhargava) - redhat/Makefile: Split up setup-source target (Prarit Bhargava) - create-data.sh: Redefine varfilename (Prarit Bhargava) - create-data.sh: Parallelize variable file creation (Prarit Bhargava) - redhat/configs: Enable CONFIG_LZ4_COMPRESS (Prarit Bhargava) - redhat/docs: Update brew information (Prarit Bhargava) - redhat/Makefile: Fix eln BUILD_TARGET (Prarit Bhargava) - redhat/Makefile: Set BUILD_TARGET for dist-brew (Prarit Bhargava) - kernel.spec.template: update (s390x) expoline.o path (Joe Lawrence) - fedora: enable BCM_NET_PHYPTP (Peter Robinson) - Fedora 5.19 configs update part 2 (Justin M. Forbes) - redhat/Makefile: Change fedora BUILD_TARGET (Prarit Bhargava) - New configs in security/keys (Fedora Kernel Team) - Fedora: arm: enable a pair of drivers (Peter Robinson) - redhat: make kernel-zfcpdump-core to not provide kernel-core/kernel (Herton R. Krzesinski) - redhat/configs: Enable QAT devices for arches other than x86 (Vladis Dronov) - Fedora 5.19 configs pt 1 (Justin M. Forbes) - redhat: Exclude cpufreq.h from kernel-headers (Patrick Talbert) - Add rtla subpackage for kernel-tools (Justin M. Forbes) - fedora: arm: enable a couple of QCom drivers (Peter Robinson) - redhat/Makefile: Deprecate BUILD_SCRATCH_TARGET (Prarit Bhargava) - redhat: enable CONFIG_DEVTMPFS_SAFE (Mark Langsdorf) - redhat/Makefile: Remove deprecated variables and targets (Prarit Bhargava) - Split partner modules into a sub-package (Alice Mitchell) - Enable kAFS and it's dependancies in RHEL (Alice Mitchell) - Enable Marvell OcteonTX2 crypto device in ARK (Vladis Dronov) - redhat/Makefile: Remove --scratch from BUILD_TARGET (Prarit Bhargava) - redhat/Makefile: Fix dist-brew and distg-brew targets (Prarit Bhargava) - fedora: arm64: Initial support for TI Keystone 3 (ARCH_K3) (Peter Robinson) - fedora: arm: enable Hardware Timestamping Engine support (Peter Robinson) - fedora: wireless: disable SiLabs and PureLiFi (Peter Robinson) - fedora: updates for 5.19 (Peter Robinson) - fedora: minor updates for Fedora configs (Peter Robinson) - configs/fedora: Enable the pinctrl SC7180 driver built-in (Enric Balletbo i Serra) - redhat/configs: enable CONFIG_DEBUG_NET for debug kernel (Hangbin Liu) - redhat/Makefile: Add SPECKABIVERSION variable (Prarit Bhargava) - redhat/self-test: Provide better failure output (Prarit Bhargava) - redhat/self-test: Reformat tests to kernel standard (Prarit Bhargava) - redhat/self-test: Add purpose and header to each test (Prarit Bhargava) - Drop outdated CRYPTO_ECDH configs (Vladis Dronov) - Brush up crypto SHA512 and USER configs (Vladis Dronov) - Brush up crypto ECDH and ECDSA configs (Vladis Dronov) - redhat/self-test: Update data set (Prarit Bhargava) - create-data.sh: Reduce specfile data output (Prarit Bhargava) - redhat/configs: restore/fix core INTEL_LPSS configs to be builtin again (Hans de Goede) - Enable CKI on os-build MRs only (Don Zickus) - self-test: Fixup Makefile contents test (Prarit Bhargava) - redhat/self-test: self-test data update (Prarit Bhargava) - redhat/self-test: Fix up create-data.sh to not report local variables (Prarit Bhargava) - redhat/configs/fedora: Enable a set of modules used on some x86 tablets (Hans de Goede) - redhat/configs: Make INTEL_SOC_PMIC_CHTDC_TI builtin (Hans de Goede) - redhat/configs/fedora: enable missing modules modules for Intel IPU3 camera support (Hans de Goede) - Common: minor cleanups (Peter Robinson) - fedora: some minor Fedora cleanups (Peter Robinson) - fedora: drop X86_PLATFORM_DRIVERS_DELL dupe (Peter Robinson) - redhat: change tools_make macro to avoid full override of variables in Makefile (Herton R. Krzesinski) - Fix typo in Makefile for Fedora Stable Versioning (Justin M. Forbes) - Remove duplicates from ark/generic/s390x/zfcpdump/ (Vladis Dronov) - Move common/debug/s390x/zfcpdump/ configs to ark/debug/s390x/zfcpdump/ (Vladis Dronov) - Move common/generic/s390x/zfcpdump/ configs to ark/generic/s390x/zfcpdump/ (Vladis Dronov) - Drop RCU_EXP_CPU_STALL_TIMEOUT to 0, we are not really android (Justin M. Forbes) - redhat/configs/README: Update the README (Prarit Bhargava) - redhat/docs: fix hyperlink typo (Patrick Talbert) - all: net: remove old NIC/ATM drivers that use virt_to_bus() (Peter Robinson) - Explicitly turn off CONFIG_KASAN_INLINE for ppc (Justin M. Forbes) - redhat/docs: Add a description of kernel naming (Prarit Bhargava) - Change CRYPTO_CHACHA_S390 from m to y (Justin M. Forbes) - enable CONFIG_NET_ACT_CTINFO in ark (Davide Caratti) - redhat/configs: enable CONFIG_SP5100_TCO (David Arcari) - redhat/configs: Set CONFIG_VIRTIO_IOMMU on x86_64 (Eric Auger) [2089765] - Turn off KASAN_INLINE for RHEL ppc in pending (Justin M. Forbes) - redhat/kernel.spec.template: update selftest data via "make dist-self-test-data" (Denys Vlasenko) - redhat/kernel.spec.template: remove stray *.hardlink-temporary files, if any (Denys Vlasenko) - Fix up ZSMALLOC config for s390 (Justin M. Forbes) - Turn on KASAN_OUTLINE for ppc debug (Justin M. Forbes) - Turn on KASAN_OUTLINE for PPC debug to avoid mismatch (Justin M. Forbes) - Fix up crypto config mistmatches (Justin M. Forbes) - Fix up config mismatches (Justin M. Forbes) - generic/fedora: cleanup and disable Lightning Moutain SoC (Peter Robinson) - redhat: Set SND_SOC_SOF_HDA_PROBES to =m (Patrick Talbert) - Fix versioning on stable Fedora (Justin M. Forbes) - Enable PAGE_POOL_STATS for arm only (Justin M. Forbes) - Revert "Merge branch 'fix-ci-20220523' into 'os-build'" (Patrick Talbert) - Flip CONFIG_RADIO_ADAPTERS to module for Fedora (Justin M. Forbes) - redhat/Makefile: Drop quotation marks around string definitions (Prarit Bhargava) - Fedora: arm: Updates for QCom devices (Peter Robinson) - Fedora arm and generic updates for 5.17 (Peter Robinson) - enable COMMON_CLK_SI5341 for Xilinx ZYNQ-MP (Peter Robinson) - Turn on CONFIG_DM_VERITY_VERIFY_ROOTHASH_SIG_SECONDARY_KEYRING for Fedora (Justin M. Forbes) - redhat/self-test/data: Update data set (Prarit Bhargava) - Revert variable switch for lasttag (Justin M. Forbes) - redhat: Add self-tests to .gitlab-ci.yml (Prarit Bhargava) - redhat/self-test: Update data (Prarit Bhargava) - redhat/self-test: Unset Makefile variables (Prarit Bhargava) - redhat/self-test: Omit SHELL variable from test data (Prarit Bhargava) - Add CONFIG_EFI_DXE_MEM_ATTRIBUTES (Justin M. Forbes) - Update filter-modules for mlx5-vfio-pci (Justin M. Forbes) - Fedora configs for 5.18 (Justin M. Forbes) - self-test/data/create-data.sh: Avoid SINGLE_TARBALL warning (Prarit Bhargava) - redhat/Makefile: Rename PREBUILD to UPSTREAMBUILD (Prarit Bhargava) - redhat/Makefile: Rename BUILDID to LOCALVERSION (Prarit Bhargava) - redhat/Makefile: Fix dist-brew & distg-brew targets (Prarit Bhargava) - redhat/Makefile: Reorganize MARKER code (Prarit Bhargava) - redhat/scripts/new_release.sh: Use Makefile variables (Prarit Bhargava) - redhat/Makefile: Rename __YSTREAM and __ZSTREAM (Prarit Bhargava) - redhat/genspec.sh: Add comment about SPECBUILDID variable (Prarit Bhargava) - redhat/kernel.spec.template: Move genspec variables into one section (Prarit Bhargava) - redhat/kernel.spec.template: Remove kversion (Prarit Bhargava) - redhat/Makefile: Add SPECTARFILE_RELEASE comment (Prarit Bhargava) - redhat/Makefile: Rename RPMVERSION to BASEVERSION (Prarit Bhargava) - redhat/Makefile: Target whitespace cleanup (Prarit Bhargava) - redhat/Makefile: Move SPECRELEASE to genspec.sh (Prarit Bhargava) - redhat/Makefile: Add kernel-NVR comment (Prarit Bhargava) - redhat/Makefile: Use SPECFILE variable (Prarit Bhargava) - redhat/Makefile: Remove KEXTRAVERSION (Prarit Bhargava) - redhat: Enable VM kselftests (Nico Pache) [1978539] - redhat: enable CONFIG_TEST_VMALLOC for vm selftests (Nico Pache) - redhat: Enable HMM test to be used by the kselftest test suite (Nico Pache) - redhat/Makefile.variables: Change git hash length to default (Prarit Bhargava) - redhat/Makefile: Drop quotation marks around string definitions (Prarit Bhargava) - Turn on INTEGRITY_MACHINE_KEYRING for Fedora (Justin M. Forbes) - redhat/configs: fix CONFIG_INTEL_ISHTP_ECLITE (David Arcari) - redhat/configs: Fix rm warning on error (Prarit Bhargava) - Fix nightly merge CI (Don Zickus) - redhat/kernel.spec.template: fix standalone tools build (Jan Stancek) - Add system-sb-certs for RHEL-9 (Don Zickus) - Fix dist-buildcheck-reqs (Don Zickus) - move DAMON configs to correct directory (Chris von Recklinghausen) - redhat: indicate HEAD state in tarball/rpm name (Jarod Wilson) - Fedora 5.18 config set part 1 (Justin M. Forbes) - fedora: arm: Enable new Rockchip 356x series drivers (Peter Robinson) - fedora: arm: enable DRM_I2C_NXP_TDA998X on aarch64 (Peter Robinson) - redhat/self-test: Add test to verify Makefile declarations. (Prarit Bhargava) - redhat/Makefile: Add RHTEST (Prarit Bhargava) - redhat: shellcheck cleanup (Prarit Bhargava) - redhat/self-test/data: Cleanup data (Prarit Bhargava) - redhat/self-test: Add test to verify SPEC variables (Prarit Bhargava) - redhat/Makefile: Add 'duplicate' SPEC entries for user set variables (Prarit Bhargava) - redhat/Makefile: Rename TARFILE_RELEASE to SPECTARFILE_RELEASE (Prarit Bhargava) - redhat/genspec: Rename PATCHLIST_CHANGELOG to SPECPATCHLIST_CHANGELOG (Prarit Bhargava) - redhat/genspec: Rename DEBUG_BUILDS_ENABLED to SPECDEBUG_BUILDS_ENABLED (Prarit Bhargava) - redhat/Makefile: Rename PKGRELEASE to SPECBUILD (Prarit Bhargava) - redhat/genspec: Rename BUILDID_DEFINE to SPECBUILDID (Prarit Bhargava) - redhat/Makefile: Rename CHANGELOG to SPECCHANGELOG (Prarit Bhargava) - redhat/Makefile: Rename RPMKEXTRAVERSION to SPECKEXTRAVERSION (Prarit Bhargava) - redhat/Makefile: Rename RPMKSUBLEVEL to SPECKSUBLEVEL (Prarit Bhargava) - redhat/Makefile: Rename RPMKPATCHLEVEL to SPECKPATCHLEVEL (Prarit Bhargava) - redhat/Makefile: Rename RPMKVERSION to SPECKVERSION (Prarit Bhargava) - redhat/Makefile: Rename KVERSION to SPECVERSION (Prarit Bhargava) - redhat/Makefile: Deprecate some simple targets (Prarit Bhargava) - redhat/Makefile: Use KVERSION (Prarit Bhargava) - redhat/configs: Set GUP_TEST in debug kernel (Joel Savitz) - enable DAMON configs (Chris von Recklinghausen) [2004233] - redhat: add zstream switch for zstream release numbering (Herton R. Krzesinski) - redhat: change kabi tarballs to use the package release (Herton R. Krzesinski) - redhat: generate distgit changelog in genspec.sh as well (Herton R. Krzesinski) - redhat: make genspec prefer metadata from git notes (Herton R. Krzesinski) - redhat: use tags from git notes for zstream to generate changelog (Herton R. Krzesinski) - ARK: Remove code marking devices unmaintained (Peter Georg) - rh_message: Fix function name (Peter Georg) [2019377] - Turn on CONFIG_RANDOM_TRUST_BOOTLOADER (Justin M. Forbes) - redhat/configs: aarch64: enable CPU_FREQ_GOV_SCHEDUTIL (Mark Salter) - Move CONFIG_HW_RANDOM_CN10K to a proper place (Vladis Dronov) - redhat/self-test: Clean up data set (Prarit Bhargava) - redhat/Makefile.rhpkg: Remove quotes for RHDISTGIT (Prarit Bhargava) - redhat/scripts/create-tarball.sh: Use Makefile variables (Prarit Bhargava) - redhat/Makefile: Deprecate SINGLE_TARBALL (Prarit Bhargava) - redhat/Makefile: Move SINGLE_TARBALL to Makefile.variables (Prarit Bhargava) - redhat/Makefile: Use RPMVERSION (Prarit Bhargava) - redhat/scripts/rh-dist-git.sh: Use Makefile variables (Prarit Bhargava) - redhat/configs/build_configs.sh: Use Makefile variables (Prarit Bhargava) - redhat/configs/process_configs.sh: Use Makefile variables (Prarit Bhargava) - redhat/kernel.spec.template: Use RPM_BUILD_NCPUS (Prarit Bhargava) - redhat/configs/generate_all_configs.sh: Use Makefile variables (Prarit Bhargava) - redhat/configs: enable nf_tables SYNPROXY extension on ark (Davide Caratti) - fedora: Disable fbdev drivers missed before (Javier Martinez Canillas) - Redhat: enable Kfence on production servers (Nico Pache) - redhat: ignore known empty patches on the patches rpminspect test (Herton R. Krzesinski) - kernel-ark: arch_hw Update CONFIG_MOUSE_VSXXXAA=m (Tony Camuso) [2062909] - spec: keep .BTF section in modules for s390 (Yauheni Kaliuta) [2071969] - kernel.spec.template: Ship arch/s390/lib/expoline.o in kernel-devel (Ondrej Mosnacek) - redhat: disable tv/radio media device infrastructure (Jarod Wilson) - redhat/configs: clean up INTEL_LPSS configuration (David Arcari) - Have to rename the actual contents too (Justin M. Forbes) - The CONFIG_SATA_MOBILE_LPM_POLICY rebane was reverted (Justin M. Forbes) - redhat: Enable KASAN on all ELN debug kernels (Nico Pache) - redhat: configs: Enable INTEL_IOMMU_DEBUGFS for debug builds (Jerry Snitselaar) - generic: can: disable CAN_SOFTING everywhere (Peter Robinson) - redhat/configs: Enable CONFIG_DM_ERA=m for all (Yanko Kaneti) - redhat/configs: enable CONFIG_SAMPLE_VFIO_MDEV_MTTY (Patrick Talbert) - Build intel_sdsi with %{tools_make} (Justin M. Forbes) - configs: remove redundant Fedora config for INTEL_IDXD_COMPAT (Jerry Snitselaar) - redhat/configs: enable CONFIG_RANDOMIZE_KSTACK_OFFSET_DEFAULT (Joel Savitz) [2026319] - configs: enable CONFIG_RMI4_F3A (Benjamin Tissoires) - redhat: configs: Disable TPM 1.2 specific drivers (Jerry Snitselaar) - redhat/configs: Enable cr50 I2C TPM interface (Akihiko Odaki) - spec: make HMAC file encode relative path (Jonathan Lebon) - redhat/kernel.spec.template: Add intel_sdsi utility (Prarit Bhargava) - Spec fixes for intel-speed-select (Justin M. Forbes) - Add Partner Supported taint flag to kAFS (Alice Mitchell) [2038999] - Add Partner Supported taint flag (Alice Mitchell) [2038999] - Enabled INTEGRITY_MACHINE_KEYRING for all configs. (Peter Robinson) - redhat/configs: Enable CONFIG_RCU_SCALE_TEST & CONFIG_RCU_REF_SCALE_TEST (Waiman Long) - Add clk_test and clk-gate_test to mod-internal.list (Justin M. Forbes) - redhat/self-tests: Ignore UPSTREAM (Prarit Bhargava) - redhat/self-tests: Ignore RHGITURL (Prarit Bhargava) - redhat/Makefile.variables: Extend git hash length to 15 (Prarit Bhargava) - redhat/self-test: Remove changelog from spec files (Prarit Bhargava) - redhat/genspec.sh: Rearrange genspec.sh (Prarit Bhargava) - redhat/self-test: Add spec file data (Prarit Bhargava) - redhat/self-test: Add better dist-dump-variables test (Prarit Bhargava) - redhat/self-test: Add variable test data (Prarit Bhargava) - redhat/config: Remove obsolete CONFIG_MFD_INTEL_PMT (David Arcari) - redhat/configs: enable CONFIG_INTEL_ISHTP_ECLITE (David Arcari) - Avoid creating files in $RPM_SOURCE_DIR (Nicolas Chauvet) - Flip CRC64 from off to y (Justin M. Forbes) - New configs in lib/Kconfig (Fedora Kernel Team) - disable redundant assignment of CONFIG_BQL on ARK (Davide Caratti) - redhat/configs: remove unnecessary GPIO options for aarch64 (Brian Masney) - redhat/configs: remove viperboard related Kconfig options (Brian Masney) - redhat/configs/process_configs.sh: Avoid race with find (Prarit Bhargava) - redhat/configs/process_configs.sh: Remove CONTINUEONERROR (Prarit Bhargava) - Remove i686 configs and filters (Justin M. Forbes) - redhat/configs: Set CONFIG_X86_AMD_PSTATE built-in on Fedora (Prarit Bhargava) - Fix up mismatch with CRC64 (Justin M. Forbes) - Fedora config updates to fix process_configs (Justin M. Forbes) - redhat: Fix release tagging (Prarit Bhargava) - redhat/self-test: Fix version tag test (Prarit Bhargava) - redhat/self-test: Fix BUILD verification test (Prarit Bhargava) - redhat/self-test: Cleanup SRPM related self-tests (Prarit Bhargava) - redhat/self-test: Fix shellcheck test (Prarit Bhargava) - redhat/configs: Disable watchdog components (Prarit Bhargava) - redhat/README.Makefile: Add a Makefile README file (Prarit Bhargava) - redhat/Makefile: Remove duplicated code (Prarit Bhargava) - Add BuildRequires libnl3-devel for intel-speed-select (Justin M. Forbes) - Add new kunit tests for 5.18 to mod-internal.list (Justin M. Forbes) - Fix RHDISTGIT for Fedora (Justin M. Forbes) - redhat/configs/process_configs.sh: Fix race with tools generation (Prarit Bhargava) - New configs in drivers/dax (Fedora Kernel Team) - Fix up CONFIG_SND_AMD_ACP_CONFIG files (Patrick Talbert) - Remove CONFIG_SND_SOC_SOF_DEBUG_PROBES files (Patrick Talbert) - SATA_MOBILE_LPM_POLICY is now SATA_LPM_POLICY (Justin M. Forbes) - Define SNAPSHOT correctly when VERSION_ON_UPSTREAM is 0 (Justin M. Forbes) - redhat/Makefile: Fix dist-git (Prarit Bhargava) - Change the pending-ark CONFIG_DAX to y due to mismatch (Justin M. Forbes) - Enable net reference count trackers in all debug kernels (Jiri Benc) - redhat/Makefile: Reorganize variables (Prarit Bhargava) - redhat/Makefile: Add some descriptions (Prarit Bhargava) - redhat/Makefile: Move SNAPSHOT check (Prarit Bhargava) - redhat/Makefile: Deprecate BREW_FLAGS, KOJI_FLAGS, and TEST_FLAGS (Prarit Bhargava) - redhat/genspec.sh: Rework RPMVERSION variable (Prarit Bhargava) - redhat/Makefile: Remove dead comment (Prarit Bhargava) - redhat/Makefile: Cleanup KABI* variables. (Prarit Bhargava) - redhat/Makefile.variables: Default RHGITCOMMIT to HEAD (Prarit Bhargava) - redhat/scripts/create-tarball.sh: Use Makefile TARBALL variable (Prarit Bhargava) - redhat/Makefile: Remove extra DIST_BRANCH (Prarit Bhargava) - redhat/Makefile: Remove STAMP_VERSION (Prarit Bhargava) - redhat/Makefile: Move NO_CONFIGCHECKS to Makefile.variables (Prarit Bhargava) - redhat/Makefile: Move RHJOBS to Makefile.variables (Prarit Bhargava) - redhat/Makefile: Move RHGIT* variables to Makefile.variables (Prarit Bhargava) - redhat/Makefile: Move PREBUILD_GIT_ONLY to Makefile.variables (Prarit Bhargava) - redhat/Makefile: Move BUILD to Makefile.variables (Prarit Bhargava) - redhat/Makefile: Move BUILD_FLAGS to Makefile.variables. (Prarit Bhargava) - redhat/Makefile: Move BUILD_PROFILE to Makefile.variables (Prarit Bhargava) - redhat/Makefile: Move BUILD_TARGET and BUILD_SCRATCH_TARGET to Makefile.variables (Prarit Bhargava) - redhat/Makefile: Remove RHPRODUCT variable (Prarit Bhargava) - redhat/Makefile: Cleanup DISTRO variable (Prarit Bhargava) - redhat/Makefile: Move HEAD to Makefile.variables. (Prarit Bhargava) - redhat: Combine Makefile and Makefile.common (Prarit Bhargava) - redhat/koji/Makefile: Decouple koji Makefile from Makefile.common (Prarit Bhargava) - Set CONFIG_SND_SOC_SOF_MT8195 for Fedora and turn on VDPA_SIM_BLOCK (Justin M. Forbes) - Add asus_wmi_sensors modules to filters for Fedora (Justin M. Forbes) - redhat: spec: trigger dracut when modules are installed separately (Jan Stancek) - Last of the Fedora 5.17 configs initial pass (Justin M. Forbes) - redhat/Makefile: Silence dist-clean-configs output (Prarit Bhargava) - Fedora 5.17 config updates (Justin M. Forbes) - Setting CONFIG_I2C_SMBUS to "m" for ark (Gopal Tiwari) - Print arch with process_configs errors (Justin M. Forbes) - Pass RHJOBS to process_configs for dist-configs-check as well (Justin M. Forbes) - redhat/configs/process_configs.sh: Fix issue with old error files (Prarit Bhargava) - redhat/configs/build_configs.sh: Parallelize execution (Prarit Bhargava) - redhat/configs/build_configs.sh: Provide better messages (Prarit Bhargava) - redhat/configs/build_configs.sh: Create unique output files (Prarit Bhargava) - redhat/configs/build_configs.sh: Add local variables (Prarit Bhargava) - redhat/configs/process_configs.sh: Parallelize execution (Prarit Bhargava) - redhat/configs/process_configs.sh: Provide better messages (Prarit Bhargava) - redhat/configs/process_configs.sh: Create unique output files (Prarit Bhargava) - redhat/configs/process_configs.sh: Add processing config function (Prarit Bhargava) - redhat: Unify genspec.sh and kernel.spec variable names (Prarit Bhargava) - redhat/genspec.sh: Remove options and use Makefile variables (Prarit Bhargava) - Add rebase note for 5.17 on Fedora stable (Justin M. Forbes) - More Fedora config updates for 5.17 (Justin M. Forbes) - redhat/configs: Disable CONFIG_MACINTOSH_DRIVERS in RHEL. (Prarit Bhargava) - redhat: Fix "make dist-release-finish" to use the correct NVR variables (Neal Gompa) [2053836] - Build CROS_EC Modules (Jason Montleon) - redhat: configs: change aarch64 default dma domain to lazy (Jerry Snitselaar) - redhat: configs: disable ATM protocols (Davide Caratti) - configs/fedora: Enable the interconnect SC7180 driver built-in (Enric Balletbo i Serra) - configs: clean up CONFIG_PAGE_TABLE_ISOLATION files (Ondrej Mosnacek) - redhat: configs: enable CONFIG_INTEL_PCH_THERMAL for RHEL x86 (David Arcari) - redhat/Makefile: Fix dist-dump-variables target (Prarit Bhargava) - redhat/configs: Enable DEV_DAX and DEV_DAX_PMEM modules on aarch64 for fedora (D Scott Phillips) - redhat/configs: Enable CONFIG_TRANSPARENT_HUGEPAGE on aarch64 for fedora (D Scott Phillips) - configs/process_configs.sh: Remove orig files (Prarit Bhargava) - redhat: configs: Disable CONFIG_MPLS for s390x/zfcpdump (Guillaume Nault) - Fedora 5.17 configs round 1 (Justin M. Forbes) - redhat: configs: disable the surface platform (David Arcari) - redhat: configs: Disable team driver (Hangbin Liu) [1945477] - configs: enable LOGITECH_FF for RHEL/CentOS too (Benjamin Tissoires) - redhat/configs: Disable CONFIG_SENSORS_NCT6683 in RHEL for arm/aarch64 (Dean Nelson) [2041186] - redhat: fix make {distg-brew,distg-koji} (Andrea Claudi) - [fedora] Turn on CONFIG_VIDEO_OV5693 for sensor support (Dave Olsthoorn) - Cleanup 'disabled' config options for RHEL (Prarit Bhargava) - redhat: move CONFIG_ARM64_MTE to aarch64 config directory (Herton R. Krzesinski) - Change CONFIG_TEST_BPF to a module (Justin M. Forbes) - Change CONFIG_TEST_BPF to module in pending MR coming for proper review (Justin M. Forbes) - redhat/configs: Enable CONFIG_TEST_BPF (Viktor Malik) - Enable KUNIT tests for testing (Nico Pache) - Makefile: Check PKGRELEASE size on dist-brew targets (Prarit Bhargava) - kernel.spec: Add glibc-static build requirement (Prarit Bhargava) - Enable iSER on s390x (Stefan Schulze Frielinghaus) - redhat/configs: Enable CONFIG_ACER_WIRELESS (Peter Georg) [2025985] - kabi: Add kABI macros for enum type (Čestmír Kalina) [2024595] - kabi: expand and clarify documentation of aux structs (Čestmír Kalina) [2024595] - kabi: introduce RH_KABI_USE_AUX_PTR (Čestmír Kalina) [2024595] - kabi: rename RH_KABI_SIZE_AND_EXTEND to AUX (Čestmír Kalina) [2024595] - kabi: more consistent _RH_KABI_SIZE_AND_EXTEND (Čestmír Kalina) [2024595] - kabi: use fixed field name for extended part (Čestmír Kalina) [2024595] - kabi: fix dereference in RH_KABI_CHECK_EXT (Čestmír Kalina) [2024595] - kabi: fix RH_KABI_SET_SIZE macro (Čestmír Kalina) [2024595] - kabi: expand and clarify documentation (Čestmír Kalina) [2024595] - kabi: make RH_KABI_USE replace any number of reserved fields (Čestmír Kalina) [2024595] - kabi: rename RH_KABI_USE2 to RH_KABI_USE_SPLIT (Čestmír Kalina) [2024595] - kabi: change RH_KABI_REPLACE2 to RH_KABI_REPLACE_SPLIT (Čestmír Kalina) [2024595] - kabi: change RH_KABI_REPLACE_UNSAFE to RH_KABI_BROKEN_REPLACE (Čestmír Kalina) [2024595] - kabi: introduce RH_KABI_ADD_MODIFIER (Čestmír Kalina) [2024595] - kabi: Include kconfig.h (Čestmír Kalina) [2024595] - kabi: macros for intentional kABI breakage (Čestmír Kalina) [2024595] - kabi: fix the note about terminating semicolon (Čestmír Kalina) [2024595] - kabi: introduce RH_KABI_HIDE_INCLUDE and RH_KABI_FAKE_INCLUDE (Čestmír Kalina) [2024595] - spec: don't overwrite auto.conf with .config (Ondrej Mosnacek) - New configs in drivers/crypto (Fedora Kernel Team) - Add test_hash to the mod-internal.list (Justin M. Forbes) - configs: disable CONFIG_CRAMFS (Abhi Das) [2041184] - spec: speed up "cp -r" when it overwrites existing files. (Denys Vlasenko) - redhat: use centos x509.genkey file if building under centos (Herton R. Krzesinski) - Revert "[redhat] Generate a crashkernel.default for each kernel build" (Coiby Xu) - spec: make linux-firmware weak(er) dependency (Jan Stancek) - rtw89: enable new driver rtw89 and device RTK8852AE (Íñigo Huguet) - Config consolidation into common (Justin M. Forbes) - Add packaged but empty /lib/modules//systemtap/ (Justin M. Forbes) - filter-modules.sh.rhel: Add ntc_thermistor to singlemods (Prarit Bhargava) - Move CONFIG_SND_SOC_TLV320AIC31XX as it is now selected by CONFIG_SND_SOC_FSL_ASOC_CARD (Justin M. Forbes) - Add dev_addr_lists_test to mod-internal.list (Justin M. Forbes) - configs/fedora: Enable CONFIG_NFC_PN532_UART for use PN532 NFC module (Ziqian SUN (Zamir)) - redhat: ignore ksamples and kselftests on the badfuncs rpminspect test (Herton R. Krzesinski) - redhat: disable upstream check for rpminspect (Herton R. Krzesinski) - redhat: switch the vsyscall config to CONFIG_LEGACY_VSYSCALL_XONLY=y (Herton R. Krzesinski) [1876977] - redhat: configs: increase CONFIG_DEBUG_KMEMLEAK_MEM_POOL_SIZE (Rafael Aquini) - move CONFIG_STRICT_SIGALTSTACK_SIZE to the appropriate directory (David Arcari) - redhat/configs: Enable CONFIG_DM_MULTIPATH_IOA for fedora (Benjamin Marzinski) - redhat/configs: Enable CONFIG_DM_MULTIPATH_HST (Benjamin Marzinski) [2000835] - redhat: Pull in openssl-devel as a build dependency correctly (Neal Gompa) [2034670] - redhat/configs: Migrate ZRAM_DEF_* configs to common/ (Neal Gompa) - redhat/configs: Enable CONFIG_CRYPTO_ZSTD (Neal Gompa) [2032758] - Turn CONFIG_DEVMEM back off for aarch64 (Justin M. Forbes) - Clean up excess text in Fedora config files (Justin M. Forbes) - Fedora config updates for 5.16 (Justin M. Forbes) - redhat/configs: enable CONFIG_INPUT_KEYBOARD for AARCH64 (Vitaly Kuznetsov) - Fedora configs for 5.16 pt 1 (Justin M. Forbes) - redhat/configs: NFS: disable UDP, insecure enctypes (Benjamin Coddington) [1952863] - Update rebase-notes with dracut 5.17 information (Justin M. Forbes) - redhat/configs: Enable CONFIG_CRYPTO_BLAKE2B (Neal Gompa) [2031547] - Enable CONFIG_BPF_SYSCALL for zfcpdump (Jiri Olsa) - Enable CONFIG_CIFS_SMB_DIRECT for ARK (Ronnie Sahlberg) - mt76: enable new device MT7921E in CentOs/RHEL (Íñigo Huguet) [2004821] - Disable CONFIG_DEBUG_PREEMPT on normal builds (Phil Auld) - redhat/configs: Enable CONFIG_PCI_P2PDMA for ark (Myron Stowe) - pci.h: Fix static include (Prarit Bhargava) - Enable CONFIG_VFIO_NOIOMMU for Fedora (Justin M. Forbes) - redhat/configs: enable CONFIG_NTB_NETDEV for ark (John W. Linville) - drivers/pci/pci-driver.c: Fix if/ifdef typo (Prarit Bhargava) - common: arm64: ensure all the required arm64 errata are enabled (Peter Robinson) - kernel/rh_taint.c: Update to new messaging (Prarit Bhargava) [2019377] - redhat/configs: enable CONFIG_AMD_PTDMA for ark (John W. Linville) - redhat/configs: enable CONFIG_RD_ZSTD for rhel (Tao Liu) [2020132] - fedora: build TEE as a module for all arches (Peter Robinson) - common: build TRUSTED_KEYS in everywhere (Peter Robinson) - redhat: make Patchlist.changelog generation conditional (Herton R. Krzesinski) - redhat/configs: Add two new CONFIGs (Prarit Bhargava) - redhat/configs: Remove dead CONFIG files (Prarit Bhargava) - redhat/configs/evaluate_configs: Add find dead configs option (Prarit Bhargava) - Add more rebase notes for Fedora 5.16 (Justin M. Forbes) - Fedora: Feature: Retire wireless Extensions (Peter Robinson) - fedora: arm: some SoC enablement pieces (Peter Robinson) - fedora: arm: enable PCIE_ROCKCHIP_DW for rk35xx series (Peter Robinson) - fedora: enable RTW89 802.11 WiFi driver (Peter Robinson) - fedora: arm: Enable DRM_PANEL_EDP (Peter Robinson) - fedora: sound: enable new sound drivers (Peter Robinson) - redhat/configs: unset KEXEC_SIG for s390x zfcpdump (Coiby Xu) - spec: Keep .BTF section in modules (Jiri Olsa) - Fix up PREEMPT configs (Justin M. Forbes) - New configs in drivers/media (Fedora Kernel Team) - New configs in drivers/net/ethernet/litex (Fedora Kernel Team) - spec: add bpf_testmod.ko to kselftests/bpf (Viktor Malik) - New configs in drivers/net/wwan (Fedora Kernel Team) - New configs in drivers/i2c (Fedora Kernel Team) - redhat/docs/index.rst: Add local build information. (Prarit Bhargava) - Fix up preempt configs (Justin M. Forbes) - Turn on CONFIG_HID_NINTENDO for controller support (Dave Olsthoorn) - Fedora: Enable MediaTek bluetooth pieces (Peter Robinson) - Add rebase notes to check for PCI patches (Justin M. Forbes) - redhat: configs: move CONFIG_ACCESSIBILITY from fedora to common (John W. Linville) - Filter updates for hid-playstation on Fedora (Justin M. Forbes) - Enable CONFIG_VIRT_DRIVERS for ARK (Vitaly Kuznetsov) - redhat/configs: Enable Nitro Enclaves on aarch64 (Vitaly Kuznetsov) - Enable e1000 in rhel9 as unsupported (Ken Cox) [2002344] - Turn on COMMON_CLK_AXG_AUDIO for Fedora rhbz 2020481 (Justin M. Forbes) - Fix up fedora config options from mismatch (Justin M. Forbes) - Add nct6775 to filter-modules.sh.rhel (Justin M. Forbes) - Enable PREEMPT_DYNAMIC for all but s390x (Justin M. Forbes) - Add memcpy_kunit to mod-internal.list (Justin M. Forbes) - New configs in fs/ksmbd (Fedora Kernel Team) - Add nct6775 to Fedora filter-modules.sh (Justin M. Forbes) - New configs in fs/ntfs3 (Fedora Kernel Team) - Make CONFIG_IOMMU_DEFAULT_DMA_STRICT default for all but x86 (Justin M. Forbes) - redhat/configs: enable KEXEC_IMAGE_VERIFY_SIG for RHEL (Coiby Xu) - redhat/configs: enable KEXEC_SIG for aarch64 RHEL (Coiby Xu) [1994858] - Fix up fedora and pending configs for PREEMPT to end mismatch (Justin M. Forbes) - Enable binder for fedora (Justin M. Forbes) - redhat: configs: Update configs for vmware (Kamal Heib) - Fedora configs for 5.15 (Justin M. Forbes) - redhat/kernel.spec.template: don't hardcode gcov arches (Jan Stancek) - redhat/configs: create a separate config for gcov options (Jan Stancek) - Update documentation with FAQ and update frequency (Don Zickus) - Document force pull option for mirroring (Don Zickus) - Ignore the rhel9 kabi files (Don Zickus) - Remove legacy elrdy cruft (Don Zickus) - redhat/configs/evaluate_configs: walk cfgvariants line by line (Jan Stancek) - redhat/configs/evaluate_configs: insert EMPTY tags at correct place (Jan Stancek) - redhat: make dist-srpm-gcov add to BUILDOPTS (Jan Stancek) - Build CONFIG_SPI_PXA2XX as a module on x86 (Justin M. Forbes) - redhat/configs: enable CONFIG_BCMGENET as module (Joel Savitz) - Fedora config updates (Justin M. Forbes) - Enable CONFIG_FAIL_SUNRPC for debug builds (Justin M. Forbes) - fedora: Disable fbdev drivers and use simpledrm instead (Javier Martinez Canillas) - spec: Don't fail spec build if ksamples fails (Jiri Olsa) - Enable CONFIG_QCOM_SCM for arm (Justin M. Forbes) - redhat: Disable clang's integrated assembler on ppc64le and s390x (Tom Stellard) - redhat/configs: enable CONFIG_IMA_WRITE_POLICY (Bruno Meneguele) - Fix dist-srpm-gcov (Don Zickus) - redhat: configs: add CONFIG_NTB and related items (John W. Linville) - Add kfence_test to mod-internal.list (Justin M. Forbes) - Enable KUNIT tests for redhat kernel-modules-internal (Nico Pache) - redhat: add *-matched meta packages to rpminspect emptyrpm config (Herton R. Krzesinski) - Use common config for NODES_SHIFT (Mark Salter) - redhat: fix typo and make the output more silent for dist-git sync (Herton R. Krzesinski) - Fedora NTFS config updates (Justin M. Forbes) - Fedora 5.15 configs part 1 (Justin M. Forbes) - Fix ordering in genspec args (Justin M. Forbes) - redhat/configs: Enable Hyper-V guests on ARM64 (Vitaly Kuznetsov) [2007430] - redhat: configs: Enable CONFIG_THINKPAD_LMI (Hans de Goede) - redhat/docs: update Koji link to avoid redirect (Joel Savitz) - redhat: add support for different profiles with dist*-brew (Herton R. Krzesinski) - redhat: configs: Disable xtables and ipset (Phil Sutter) [1945179] - redhat: Add mark_driver_deprecated() (Phil Sutter) [1945179] - Change s390x CONFIG_NODES_SHIFT from 4 to 1 (Justin M. Forbes) - Build CRYPTO_SHA3_*_S390 inline for s390 zfcpdump (Justin M. Forbes) - redhat: move the DIST variable setting to Makefile.variables (Herton R. Krzesinski) - redhat/kernel.spec.template: Cleanup source numbering (Prarit Bhargava) - redhat/kernel.spec.template: Reorganize RHEL and Fedora specific files (Prarit Bhargava) - redhat/kernel.spec.template: Add include_fedora and include_rhel variables (Prarit Bhargava) - redhat/Makefile: Make kernel-local global (Prarit Bhargava) - redhat/Makefile: Use flavors file (Prarit Bhargava) - Turn on CONFIG_CPU_FREQ_GOV_SCHEDUTIL for x86 (Justin M. Forbes) - redhat/configs: Remove CONFIG_INFINIBAND_I40IW (Kamal Heib) - cleanup CONFIG_X86_PLATFORM_DRIVERS_INTEL (David Arcari) - redhat: rename usage of .rhel8git.mk to .rhpkg.mk (Herton R. Krzesinski) - Manually add pending items that need to be set due to mismatch (Justin M. Forbes) - Clean up pending common (Justin M. Forbes) - redhat/configs: Enable CONFIG_BLK_CGROUP_IOLATENCY & CONFIG_BLK_CGROUP_FC_APPID (Waiman Long) [2006813] - redhat: remove kernel.changelog-8.99 file (Herton R. Krzesinski) - redhat/configs: enable CONFIG_SQUASHFS_ZSTD which is already enabled in Fedora 34 (Tao Liu) [1998953] - redhat: bump RHEL_MAJOR and add the changelog file for it (Herton R. Krzesinski) - redhat: add documentation about the os-build rebase process (Herton R. Krzesinski) - redhat/configs: enable SYSTEM_BLACKLIST_KEYRING which is already enabled in rhel8 and Fedora 34 (Coiby Xu) - Build kernel-doc for Fedora (Justin M. Forbes) - x86_64: Enable Elkhart Lake Quadrature Encoder Peripheral support (Prarit Bhargava) - Update CONFIG_WERROR to disabled as it can cause issue with out of tree modules. (Justin M. Forbes) - Fixup IOMMU configs in pending so that configs are sane again (Justin M. Forbes) - Some initial Fedora config items for 5.15 (Justin M. Forbes) - arm64: use common CONFIG_MAX_ZONEORDER for arm kernel (Mark Salter) - Create Makefile.variables for a single point of configuration change (Justin M. Forbes) - rpmspec: drop traceevent files instead of just excluding them from files list (Herton R. Krzesinski) [1967640] - redhat/config: Enablement of CONFIG_PAPR_SCM for PowerPC (Gustavo Walbon) [1962936] - Attempt to fix Intel PMT code (David Arcari) - CI: Enable realtime branch testing (Veronika Kabatova) - CI: Enable realtime checks for c9s and RHEL9 (Veronika Kabatova) - ark: wireless: enable all rtw88 pcie wirless variants (Peter Robinson) - wireless: rtw88: move debug options to common/debug (Peter Robinson) - fedora: minor PTP clock driver cleanups (Peter Robinson) - common: x86: enable VMware PTP support on ark (Peter Robinson) - [scsi] megaraid_sas: re-add certain pci-ids (Tomas Henzl) - Disable liquidio driver on ark/rhel (Herton R. Krzesinski) [1993393] - More Fedora config updates (Justin M. Forbes) - Fedora config updates for 5.14 (Justin M. Forbes) - CI: Rename ARK CI pipeline type (Veronika Kabatova) - CI: Finish up c9s config (Veronika Kabatova) - CI: Update ppc64le config (Veronika Kabatova) - CI: use more templates (Veronika Kabatova) - Filter updates for aarch64 (Justin M. Forbes) - increase CONFIG_NODES_SHIFT for aarch64 (Chris von Recklinghausen) [1890304] - redhat: configs: Enable CONFIG_WIRELESS_HOTKEY (Hans de Goede) - redhat/configs: Update CONFIG_NVRAM (Desnes A. Nunes do Rosario) [1988254] - common: serial: build in SERIAL_8250_LPSS for x86 (Peter Robinson) - powerpc: enable CONFIG_FUNCTION_PROFILER (Diego Domingos) [1831065] - redhat/configs: Disable Soft-RoCE driver (Kamal Heib) - redhat/configs/evaluate_configs: Update help output (Prarit Bhargava) - redhat/configs: Double MAX_LOCKDEP_CHAINS (Justin M. Forbes) - fedora: configs: Fix WM5102 Kconfig (Hans de Goede) - powerpc: enable CONFIG_POWER9_CPU (Diego Domingos) [1876436] - redhat/configs: Fix CONFIG_VIRTIO_IOMMU to 'y' on aarch64 (Eric Auger) [1972795] - filter-modules.sh: add more sound modules to filter (Jaroslav Kysela) - redhat/configs: sound configuration cleanups and updates (Jaroslav Kysela) - common: Update for CXL (Compute Express Link) configs (Peter Robinson) - redhat: configs: disable CRYPTO_SM modules (Herton R. Krzesinski) [1990040] - Remove fedora version of the LOCKDEP_BITS, we should use common (Justin M. Forbes) - Re-enable sermouse for x86 (rhbz 1974002) (Justin M. Forbes) - Fedora 5.14 configs round 1 (Justin M. Forbes) - redhat: add gating configuration for centos stream/rhel9 (Herton R. Krzesinski) - x86: configs: Enable CONFIG_TEST_FPU for debug kernels (Vitaly Kuznetsov) [1988384] - redhat/configs: Move CHACHA and POLY1305 to core kernel to allow BIG_KEYS=y (root) [1983298] - kernel.spec: fix build of samples/bpf (Jiri Benc) - Enable OSNOISE_TRACER and TIMERLAT_TRACER (Jerome Marchand) [1979379] - rpmspec: switch iio and gpio tools to use tools_make (Herton R. Krzesinski) [1956988] - configs/process_configs.sh: Handle config items with no help text (Patrick Talbert) - fedora: sound config updates for 5.14 (Peter Robinson) - fedora: Only enable FSI drivers on POWER platform (Peter Robinson) - The CONFIG_RAW_DRIVER has been removed from upstream (Peter Robinson) - fedora: updates for 5.14 with a few disables for common from pending (Peter Robinson) - fedora: migrate from MFD_TPS68470 -> INTEL_SKL_INT3472 (Peter Robinson) - fedora: Remove STAGING_GASKET_FRAMEWORK (Peter Robinson) - Fedora: move DRM_VMWGFX configs from ark -> common (Peter Robinson) - fedora: arm: disabled unused FB drivers (Peter Robinson) - fedora: don't enable FB_VIRTUAL (Peter Robinson) - redhat/configs: Double MAX_LOCKDEP_ENTRIES (Waiman Long) [1940075] - rpmspec: fix verbose output on kernel-devel installation (Herton R. Krzesinski) [1981406] - Build Fedora x86s kernels with bytcr-wm5102 (Marius Hoch) - Deleted redhat/configs/fedora/generic/x86/CONFIG_FB_HYPERV (Patrick Lang) - rpmspec: correct the ghost initramfs attributes (Herton R. Krzesinski) [1977056] - rpmspec: amend removal of depmod created files to include modules.builtin.alias.bin (Herton R. Krzesinski) [1977056] - configs: remove duplicate CONFIG_DRM_HYPERV file (Patrick Talbert) - CI: use common code for merge and release (Don Zickus) - rpmspec: add release string to kernel doc directory name (Jan Stancek) - redhat/configs: Add CONFIG_INTEL_PMT_CRASHLOG (Michael Petlan) [1880486] - redhat/configs: Add CONFIG_INTEL_PMT_TELEMETRY (Michael Petlan) [1880486] - redhat/configs: Add CONFIG_MFD_INTEL_PMT (Michael Petlan) [1880486] - redhat/configs: enable CONFIG_BLK_DEV_ZONED (Ming Lei) [1638087] - Add --with clang_lto option to build the kernel with Link Time Optimizations (Tom Stellard) - common: disable DVB_AV7110 and associated pieces (Peter Robinson) - Fix fedora-only config updates (Don Zickus) - Fedor config update for new option (Justin M. Forbes) - redhat/configs: Enable stmmac NIC for x86_64 (Mark Salter) - all: hyperv: use the DRM driver rather than FB (Peter Robinson) - all: hyperv: unify the Microsoft HyperV configs (Peter Robinson) - all: VMWare: clean up VMWare configs (Peter Robinson) - Update CONFIG_ARM_FFA_TRANSPORT (Patrick Talbert) - CI: Handle all mirrors (Veronika Kabatova) - Turn on CONFIG_STACKTRACE for s390x zfpcdump kernels (Justin M. Forbes) - arm64: switch ark kernel to 4K pagesize (Mark Salter) - Disable AMIGA_PARTITION and KARMA_PARTITION (Prarit Bhargava) [1802694] - all: unify and cleanup i2c TPM2 modules (Peter Robinson) - redhat/configs: Set CONFIG_VIRTIO_IOMMU on aarch64 (Eric Auger) [1972795] - redhat/configs: Disable CONFIG_RT_GROUP_SCHED in rhel config (Phil Auld) - redhat/configs: enable KEXEC_SIG which is already enabled in RHEL8 for s390x and x86_64 (Coiby Xu) [1976835] - rpmspec: do not BuildRequires bpftool on noarch (Herton R. Krzesinski) - redhat/configs: disable {IMA,EVM}_LOAD_X509 (Bruno Meneguele) [1977529] - redhat: add secureboot CA certificate to trusted kernel keyring (Bruno Meneguele) - redhat/configs: enable IMA_ARCH_POLICY for aarch64 and s390x (Bruno Meneguele) - redhat/configs: Enable CONFIG_MLXBF_GIGE on aarch64 (Alaa Hleihel) [1858599] - common: enable STRICT_MODULE_RWX everywhere (Peter Robinson) - COMMON_CLK_STM32MP157_SCMI is bool and selects COMMON_CLK_SCMI (Justin M. Forbes) - kernel.spec: Add kernel{,-debug}-devel-matched meta packages (Timothée Ravier) - Turn off with_selftests for Fedora (Justin M. Forbes) - Don't build bpftool on Fedora (Justin M. Forbes) - Fix location of syscall scripts for kernel-devel (Justin M. Forbes) - fedora: arm: Enable some i.MX8 options (Peter Robinson) - Enable Landlock for Fedora (Justin M. Forbes) - Filter update for Fedora aarch64 (Justin M. Forbes) - rpmspec: only build debug meta packages where we build debug ones (Herton R. Krzesinski) - rpmspec: do not BuildRequires bpftool on nobuildarches (Herton R. Krzesinski) - redhat/configs: Consolidate CONFIG_HMC_DRV in the common s390x folder (Thomas Huth) [1976270] - redhat/configs: Consolidate CONFIG_EXPOLINE_OFF in the common folder (Thomas Huth) [1976270] - redhat/configs: Move CONFIG_HW_RANDOM_S390 into the s390x/ subfolder (Thomas Huth) [1976270] - redhat/configs: Disable CONFIG_HOTPLUG_PCI_SHPC in the Fedora settings (Thomas Huth) [1976270] - redhat/configs: Remove the non-existent CONFIG_NO_BOOTMEM switch (Thomas Huth) [1976270] - redhat/configs: Compile the virtio-console as a module on s390x (Thomas Huth) [1976270] - redhat/configs: Enable CONFIG_S390_CCW_IOMMU and CONFIG_VFIO_CCW for ARK, too (Thomas Huth) [1976270] - Revert "Merge branch 'ec_fips' into 'os-build'" (Vladis Dronov) [1947240] - Fix typos in fedora filters (Justin M. Forbes) - More filtering for Fedora (Justin M. Forbes) - Fix Fedora module filtering for spi-altera-dfl (Justin M. Forbes) - Fedora 5.13 config updates (Justin M. Forbes) - fedora: cleanup TCG_TIS_I2C_CR50 (Peter Robinson) - fedora: drop duplicate configs (Peter Robinson) - More Fedora config updates for 5.13 (Justin M. Forbes) - redhat/configs: Enable needed drivers for BlueField SoC on aarch64 (Alaa Hleihel) [1858592 1858594 1858596] - redhat: Rename mod-blacklist.sh to mod-denylist.sh (Prarit Bhargava) - redhat/configs: enable CONFIG_NET_ACT_MPLS (Marcelo Ricardo Leitner) - configs: Enable CONFIG_DEBUG_KERNEL for zfcpdump (Jiri Olsa) - kernel.spec: Add support to use vmlinux.h (Don Zickus) - spec: Add vmlinux.h to kernel-devel package (Jiri Olsa) - Turn off DRM_XEN_FRONTEND for Fedora as we had DRM_XEN off already (Justin M. Forbes) - Fedora 5.13 config updates pt 3 (Justin M. Forbes) - all: enable ath11k wireless modules (Peter Robinson) - all: Enable WWAN and associated MHI bus pieces (Peter Robinson) - spec: Enable sefltests rpm build (Jiri Olsa) - spec: Allow bpf selftest/samples to fail (Jiri Olsa) - kvm: Add kvm_stat.service file and kvm_stat logrotate config to the tools (Jiri Benc) - kernel.spec: Add missing source files to kernel-selftests-internal (Jiri Benc) - kernel.spec: selftests: add net/forwarding to TARGETS list (Jiri Benc) - kernel.spec: selftests: add build requirement on libmnl-devel (Jiri Benc) - kernel.spec: add action.o to kernel-selftests-internal (Jiri Benc) - kernel.spec: avoid building bpftool repeatedly (Jiri Benc) - kernel.spec: selftests require python3 (Jiri Benc) - kernel.spec: skip selftests that failed to build (Jiri Benc) - kernel.spec: fix installation of bpf selftests (Jiri Benc) - redhat: fix samples and selftests make options (Jiri Benc) - kernel.spec: enable mptcp selftests for kernel-selftests-internal (Jiri Benc) - kernel.spec: Do not export shared objects from libexecdir to RPM Provides (Jiri Benc) - kernel.spec: add missing dependency for the which package (Jiri Benc) - kernel.spec: add netfilter selftests to kernel-selftests-internal (Jiri Benc) - kernel.spec: move slabinfo and page_owner_sort debuginfo to tools-debuginfo (Jiri Benc) - kernel.spec: package and ship VM tools (Jiri Benc) - configs: enable CONFIG_PAGE_OWNER (Jiri Benc) - kernel.spec: add coreutils (Jiri Benc) - kernel.spec: add netdevsim driver selftests to kernel-selftests-internal (Jiri Benc) - redhat/Makefile: Clean out the --without flags from the baseonly rule (Jiri Benc) - kernel.spec: Stop building unnecessary rpms for baseonly builds (Jiri Benc) - kernel.spec: disable more kabi switches for gcov build (Jiri Benc) - kernel.spec: Rename kabi-dw base (Jiri Benc) - kernel.spec: Fix error messages during build of zfcpdump kernel (Jiri Benc) - kernel.spec: perf: remove bpf examples (Jiri Benc) - kernel.spec: selftests should not depend on modules-internal (Jiri Benc) - kernel.spec: build samples (Jiri Benc) - kernel.spec: tools: sync missing options with RHEL 8 (Jiri Benc) - redhat/configs: nftables: Enable extra flowtable symbols (Phil Sutter) - redhat/configs: Sync netfilter options with RHEL8 (Phil Sutter) - Fedora 5.13 config updates pt 2 (Justin M. Forbes) - Move CONFIG_ARCH_INTEL_SOCFPGA up a level for Fedora (Justin M. Forbes) - fedora: enable the Rockchip rk3399 pcie drivers (Peter Robinson) - Fedora 5.13 config updates pt 1 (Justin M. Forbes) - Fix version requirement from opencsd-devel buildreq (Justin M. Forbes) - configs/ark/s390: set CONFIG_MARCH_Z14 and CONFIG_TUNE_Z15 (Philipp Rudo) [1876435] - configs/common/s390: Clean up CONFIG_{MARCH,TUNE}_Z* (Philipp Rudo) - configs/process_configs.sh: make use of dummy-tools (Philipp Rudo) - configs/common: disable CONFIG_INIT_STACK_ALL_{PATTERN,ZERO} (Philipp Rudo) - configs/common/aarch64: disable CONFIG_RELR (Philipp Rudo) - redhat/config: enable STMICRO nic for RHEL (Mark Salter) - redhat/configs: Enable ARCH_TEGRA on RHEL (Mark Salter) - redhat/configs: enable IMA_KEXEC for supported arches (Bruno Meneguele) - redhat/configs: enable INTEGRITY_SIGNATURE to all arches (Bruno Meneguele) - configs: enable CONFIG_LEDS_BRIGHTNESS_HW_CHANGED (Benjamin Tissoires) - RHEL: disable io_uring support (Jeff Moyer) [1964537] - all: Changing CONFIG_UV_SYSFS to build uv_sysfs.ko as a loadable module. (Frank Ramsay) - Enable NITRO_ENCLAVES on RHEL (Vitaly Kuznetsov) - Update the Quick Start documentation (David Ward) - redhat/configs: Set PVPANIC_MMIO for x86 and PVPANIC_PCI for aarch64 (Eric Auger) [1961178] - bpf: Fix unprivileged_bpf_disabled setup (Jiri Olsa) - Enable CONFIG_BPF_UNPRIV_DEFAULT_OFF (Jiri Olsa) - configs/common/s390: disable CONFIG_QETH_{OSN,OSX} (Philipp Rudo) [1903201] - nvme: nvme_mpath_init remove multipath check (Mike Snitzer) - Make CRYPTO_EC also builtin (Simo Sorce) [1947240] - Do not hard-code a default value for DIST (David Ward) - Override %{debugbuildsenabled} if the --with-release option is used (David Ward) - Improve comments in SPEC file, and move some option tests and macros (David Ward) - configs: enable CONFIG_EXFAT_FS (Pavel Reichl) [1943423] - Revert s390x/zfcpdump part of a9d179c40281 and ecbfddd98621 (Vladis Dronov) - Embed crypto algos, modes and templates needed in the FIPS mode (Vladis Dronov) [1947240] - configs: Add and enable CONFIG_HYPERV_TESTING for debug kernels (Mohammed Gamal) - configs: enable CONFIG_CMA on x86_64 in ARK (David Hildenbrand) [1945002] - rpmspec: build debug-* meta-packages if debug builds are disabled (Herton R. Krzesinski) - UIO: disable unused config options (Aristeu Rozanski) [1957819] - ARK-config: Make amd_pinctrl module builtin (Hans de Goede) - rpmspec: revert/drop content hash for kernel-headers (Herton R. Krzesinski) - rpmspec: fix check that calls InitBuildVars (Herton R. Krzesinski) - fedora: enable zonefs (Damien Le Moal) - redhat: load specific ARCH keys to INTEGRITY_PLATFORM_KEYRING (Bruno Meneguele) - redhat: enable INTEGRITY_TRUSTED_KEYRING across all variants (Bruno Meneguele) - redhat: enable SYSTEM_BLACKLIST_KEYRING across all variants (Bruno Meneguele) - redhat: enable INTEGRITY_ASYMMETRIC_KEYS across all variants (Bruno Meneguele) - Remove unused boot loader specification files (David Ward) - redhat/configs: Enable mlx5 IPsec and TLS offloads (Alaa Hleihel) [1869674 1957636] - common: disable Apple Silicon generally (Peter Robinson) - cleanup Intel's FPGA configs (Peter Robinson) - common: move PTP KVM support from ark to common (Peter Robinson) - Enable CONFIG_DRM_AMDGPU_USERPTR for everyone (Justin M. Forbes) - redhat: add initial rpminspect configuration (Herton R. Krzesinski) - fedora: arm updates for 5.13 (Peter Robinson) - fedora: Enable WWAN and associated MHI bits (Peter Robinson) - Update CONFIG_MODPROBE_PATH to /usr/sbin (Justin Forbes) - Fedora set modprobe path (Justin M. Forbes) - Keep sctp and l2tp modules in modules-extra (Don Zickus) - Fix ppc64le cross build packaging (Don Zickus) - Fedora: Make amd_pinctrl module builtin (Hans de Goede) - Keep CONFIG_KASAN_HW_TAGS off for aarch64 debug configs (Justin M. Forbes) - New configs in drivers/bus (Fedora Kernel Team) - RHEL: Don't build KVM PR module on ppc64 (David Gibson) [1930649] - Flip CONFIG_USB_ROLE_SWITCH from m to y (Justin M. Forbes) - Set valid options for CONFIG_FW_LOADER_USER_HELPER (Justin M. Forbes) - Clean up CONFIG_FB_MODE_HELPERS (Justin M. Forbes) - Turn off CONFIG_VFIO for the s390x zfcpdump kernel (Justin M. Forbes) - Delete unused CONFIG_SND_SOC_MAX98390 pending-common (Justin M. Forbes) - Update pending-common configs, preparing to set correctly (Justin M. Forbes) - Update fedora filters for surface (Justin M. Forbes) - Build CONFIG_CRYPTO_ECDSA inline for s390x zfcpdump (Justin M. Forbes) - Replace "flavour" where "variant" is meant instead (David Ward) - Drop the %{variant} macro and fix --with-vanilla (David Ward) - Fix syntax of %kernel_variant_files (David Ward) - Change description of --without-vdso-install to fix typo (David Ward) - Config updates to work around mismatches (Justin M. Forbes) - CONFIG_SND_SOC_FSL_ASOC_CARD selects CONFIG_MFD_WM8994 now (Justin M. Forbes) - wireguard: disable in FIPS mode (Hangbin Liu) [1940794] - Enable mtdram for fedora (rhbz 1955916) (Justin M. Forbes) - Remove reference to bpf-helpers man page (Justin M. Forbes) - Fedora: enable more modules for surface devices (Dave Olsthoorn) - Fix Fedora config mismatch for CONFIG_FSL_ENETC_IERB (Justin M. Forbes) - hardlink is in /usr/bin/ now (Justin M. Forbes) - Ensure CONFIG_KVM_BOOK3S_64_PR stays on in Fedora, even if it is turned off in RHEL (Justin M. Forbes) - Set date in package release from repository commit, not system clock (David Ward) - Use a better upstream tarball filename for snapshots (David Ward) - Don't create empty pending-common files on pending-fedora commits (Don Zickus) - nvme: decouple basic ANA log page re-read support from native multipathing (Mike Snitzer) - nvme: allow local retry and proper failover for REQ_FAILFAST_TRANSPORT (Mike Snitzer) - nvme: Return BLK_STS_TARGET if the DNR bit is set (Mike Snitzer) - Add redhat/configs/pending-common/generic/s390x/zfcpdump/CONFIG_NETFS_SUPPORT (Justin M. Forbes) - Create ark-latest branch last for CI scripts (Don Zickus) - Replace /usr/libexec/platform-python with /usr/bin/python3 (David Ward) - Turn off ADI_AXI_ADC and AD9467 which now require CONFIG_OF (Justin M. Forbes) - Export ark infrastructure files (Don Zickus) - docs: Update docs to reflect newer workflow. (Don Zickus) - Use upstream/master for merge-base with fallback to master (Don Zickus) - Fedora: Turn off the SND_INTEL_BYT_PREFER_SOF option (Hans de Goede) - filter-modules.sh.fedora: clean up "netprots" (Paul Bolle) - filter-modules.sh.fedora: clean up "scsidrvs" (Paul Bolle) - filter-*.sh.fedora: clean up "ethdrvs" (Paul Bolle) - filter-*.sh.fedora: clean up "driverdirs" (Paul Bolle) - filter-*.sh.fedora: remove incorrect entries (Paul Bolle) - filter-*.sh.fedora: clean up "singlemods" (Paul Bolle) - filter-modules.sh.fedora: drop unused list "iiodrvs" (Paul Bolle) - Update mod-internal to fix depmod issue (Nico Pache) - Turn on CONFIG_VDPA_SIM_NET (rhbz 1942343) (Justin M. Forbes) - New configs in drivers/power (Fedora Kernel Team) - Turn on CONFIG_NOUVEAU_DEBUG_PUSH for debug configs (Justin M. Forbes) - Turn off KFENCE sampling by default for Fedora (Justin M. Forbes) - Fedora config updates round 2 (Justin M. Forbes) - New configs in drivers/soc (Jeremy Cline) - filter-modules.sh: Fix copy/paste error 'input' (Paul Bolle) - Update module filtering for 5.12 kernels (Justin M. Forbes) - Fix genlog.py to ensure that comments retain "%" characters. (Mark Mielke) - New configs in drivers/leds (Fedora Kernel Team) - Limit CONFIG_USB_CDNS_SUPPORT to x86_64 and arm in Fedora (David Ward) - Fedora: Enable CHARGER_GPIO on aarch64 too (Peter Robinson) - Fedora config updates (Justin M. Forbes) - configs: enable CONFIG_WIREGUARD in ARK (Hangbin Liu) [1613522] - Remove duplicate configs acroos fedora, ark and common (Don Zickus) - Combine duplicate configs across ark and fedora into common (Don Zickus) - common/ark: cleanup and unify the parport configs (Peter Robinson) - iommu/vt-d: enable INTEL_IDXD_SVM for both fedora and rhel (Jerry Snitselaar) - REDHAT: coresight: etm4x: Disable coresight on HPE Apollo 70 (Jeremy Linton) - configs/common/generic: disable CONFIG_SLAB_MERGE_DEFAULT (Rafael Aquini) - Remove _legacy_common_support (Justin M. Forbes) - redhat/mod-blacklist.sh: Fix floppy blacklisting (Hans de Goede) - New configs in fs/pstore (CKI@GitLab) - New configs in arch/powerpc (Fedora Kernel Team) - configs: enable BPF LSM on Fedora and ARK (Ondrej Mosnacek) - configs: clean up LSM configs (Ondrej Mosnacek) - New configs in drivers/platform (CKI@GitLab) - New configs in drivers/firmware (CKI@GitLab) - New configs in drivers/mailbox (Fedora Kernel Team) - New configs in drivers/net/phy (Justin M. Forbes) - Update CONFIG_DM_MULTIPATH_IOA (Augusto Caringi) - New configs in mm/Kconfig (CKI@GitLab) - New configs in arch/powerpc (Jeremy Cline) - New configs in arch/powerpc (Jeremy Cline) - New configs in drivers/input (Fedora Kernel Team) - New configs in net/bluetooth (Justin M. Forbes) - New configs in drivers/clk (Fedora Kernel Team) - New configs in init/Kconfig (Jeremy Cline) - redhat: allow running fedora-configs and rh-configs targets outside of redhat/ (Herton R. Krzesinski) - all: unify the disable of goldfish (android emulation platform) (Peter Robinson) - common: minor cleanup/de-dupe of dma/dmabuf debug configs (Peter Robinson) - common/ark: these drivers/arches were removed in 5.12 (Peter Robinson) - Correct kernel-devel make prepare build for 5.12. (Paulo E. Castro) - redhat: add initial support for centos stream dist-git sync on Makefiles (Herton R. Krzesinski) - redhat/configs: Enable CONFIG_SCHED_STACK_END_CHECK for Fedora and ARK (Josh Poimboeuf) [1856174] - CONFIG_VFIO now selects IOMMU_API instead of depending on it, causing several config mismatches for the zfcpdump kernel (Justin M. Forbes) - Turn off weak-modules for Fedora (Justin M. Forbes) - redhat: enable CONFIG_FW_LOADER_COMPRESS for ARK (Herton R. Krzesinski) [1939095] - Fedora: filters: update to move dfl-emif to modules (Peter Robinson) - drop duplicate DEVFREQ_GOV_SIMPLE_ONDEMAND config (Peter Robinson) - efi: The EFI_VARS is legacy and now x86 only (Peter Robinson) - common: enable RTC_SYSTOHC to supplement update_persistent_clock64 (Peter Robinson) - generic: arm: enable SCMI for all options (Peter Robinson) - fedora: the PCH_CAN driver is x86-32 only (Peter Robinson) - common: disable legacy CAN device support (Peter Robinson) - common: Enable Microchip MCP251x/MCP251xFD CAN controllers (Peter Robinson) - common: Bosch MCAN support for Intel Elkhart Lake (Peter Robinson) - common: enable CAN_PEAK_PCIEFD PCI-E driver (Peter Robinson) - common: disable CAN_PEAK_PCIEC PCAN-ExpressCard (Peter Robinson) - common: enable common CAN layer 2 protocols (Peter Robinson) - ark: disable CAN_LEDS option (Peter Robinson) - Fedora: Turn on SND_SOC_INTEL_SKYLAKE_HDAUDIO_CODEC option (Hans de Goede) - Fedora: enable modules for surface devices (Dave Olsthoorn) - Turn on SND_SOC_INTEL_SOUNDWIRE_SOF_MACH for Fedora again (Justin M. Forbes) - common: fix WM8804 codec dependencies (Peter Robinson) - Build SERIO_SERPORT as a module (Peter Robinson) - input: touchscreen: move ELO and Wacom serial touchscreens to x86 (Peter Robinson) - Sync serio touchscreens for non x86 architectures to the same as ARK (Peter Robinson) - Only enable SERIO_LIBPS2 on x86 (Peter Robinson) - Only enable PC keyboard controller and associated keyboard on x86 (Peter Robinson) - Generic: Mouse: Tweak generic serial mouse options (Peter Robinson) - Only enable PS2 Mouse options on x86 (Peter Robinson) - Disable bluetooth highspeed by default (Peter Robinson) - Fedora: A few more general updates for 5.12 window (Peter Robinson) - Fedora: Updates for 5.12 merge window (Peter Robinson) - Fedora: remove dead options that were removed upstream (Peter Robinson) - redhat: remove CONFIG_DRM_PANEL_XINGBANGDA_XBD599 (Herton R. Krzesinski) - New configs in arch/powerpc (Fedora Kernel Team) - Turn on CONFIG_PPC_QUEUED_SPINLOCKS as it is default upstream now (Justin M. Forbes) - Update pending-common configs to address new upstream config deps (Justin M. Forbes) - rpmspec: ship gpio-watch.debug in the proper debuginfo package (Herton R. Krzesinski) - Removed description text as a comment confuses the config generation (Justin M. Forbes) - New configs in drivers/dma-buf (Jeremy Cline) - Fedora: ARMv7: build for 16 CPUs. (Peter Robinson) - Fedora: only enable DEBUG_HIGHMEM on debug kernels (Peter Robinson) - process_configs.sh: fix find/xargs data flow (Ondrej Mosnacek) - Fedora config update (Justin M. Forbes) - fedora: minor arm sound config updates (Peter Robinson) - Fix trailing white space in redhat/configs/fedora/generic/CONFIG_SND_INTEL_BYT_PREFER_SOF (Justin M. Forbes) - Add a redhat/rebase-notes.txt file (Hans de Goede) - Turn on SND_INTEL_BYT_PREFER_SOF for Fedora (Hans de Goede) - CI: Drop MR ID from the name variable (Veronika Kabatova) - redhat: add DUP and kpatch certificates to system trusted keys for RHEL build (Herton R. Krzesinski) - The comments in CONFIG_USB_RTL8153_ECM actually turn off CONFIG_USB_RTL8152 (Justin M. Forbes) - Update CKI pipeline project (Veronika Kabatova) - Turn off additional KASAN options for Fedora (Justin M. Forbes) - Rename the master branch to rawhide for Fedora (Justin M. Forbes) - Makefile targets for packit integration (Ben Crocker) - Turn off KASAN for rawhide debug builds (Justin M. Forbes) - New configs in arch/arm64 (Justin Forbes) - Remove deprecated Intel MIC config options (Peter Robinson) - redhat: replace inline awk script with genlog.py call (Herton R. Krzesinski) - redhat: add genlog.py script (Herton R. Krzesinski) - kernel.spec.template - fix use_vdso usage (Ben Crocker) - redhat: remove remaining references of CONFIG_RH_DISABLE_DEPRECATED (Herton R. Krzesinski) - Turn off vdso_install for ppc (Justin M. Forbes) - Remove bpf-helpers.7 from bpftool package (Jiri Olsa) - New configs in lib/Kconfig.debug (Fedora Kernel Team) - Turn off CONFIG_VIRTIO_CONSOLE for s390x zfcpdump (Justin M. Forbes) - New configs in drivers/clk (Justin M. Forbes) - Keep VIRTIO_CONSOLE on s390x available. (Jakub Čajka) - New configs in lib/Kconfig.debug (Jeremy Cline) - Fedora 5.11 config updates part 4 (Justin M. Forbes) - Fedora 5.11 config updates part 3 (Justin M. Forbes) - Fedora 5.11 config updates part 2 (Justin M. Forbes) - Update internal (test) module list from RHEL-8 (Joe Lawrence) [1915073] - Fix USB_XHCI_PCI regression (Justin M. Forbes) - fedora: fixes for ARMv7 build issue by disabling HIGHPTE (Peter Robinson) - all: s390x: Increase CONFIG_PCI_NR_FUNCTIONS to 512 (#1888735) (Dan Horák) - Fedora 5.11 configs pt 1 (Justin M. Forbes) - redhat: avoid conflict with mod-blacklist.sh and released_kernel defined (Herton R. Krzesinski) - redhat: handle certificate files conditionally as done for src.rpm (Herton R. Krzesinski) - specfile: add %{?_smp_mflags} to "make headers_install" in tools/testing/selftests (Denys Vlasenko) - specfile: add %{?_smp_mflags} to "make samples/bpf/" (Denys Vlasenko) - Run MR testing in CKI pipeline (Veronika Kabatova) - Reword comment (Nicolas Chauvet) - Add with_cross_arm conditional (Nicolas Chauvet) - Redefines __strip if with_cross (Nicolas Chauvet) - fedora: only enable ACPI_CONFIGFS, ACPI_CUSTOM_METHOD in debug kernels (Peter Robinson) - fedora: User the same EFI_CUSTOM_SSDT_OVERLAYS as ARK (Peter Robinson) - all: all arches/kernels enable the same DMI options (Peter Robinson) - all: move SENSORS_ACPI_POWER to common/generic (Peter Robinson) - fedora: PCIE_HISI_ERR is already in common (Peter Robinson) - all: all ACPI platforms enable ATA_ACPI so move it to common (Peter Robinson) - all: x86: move shared x86 acpi config options to generic (Peter Robinson) - All: x86: Move ACPI_VIDEO to common/x86 (Peter Robinson) - All: x86: Enable ACPI_DPTF (Intel DPTF) (Peter Robinson) - All: enable ACPI_BGRT for all ACPI platforms. (Peter Robinson) - All: Only build ACPI_EC_DEBUGFS for debug kernels (Peter Robinson) - All: Disable Intel Classmate PC ACPI_CMPC option (Peter Robinson) - cleanup: ACPI_PROCFS_POWER was removed upstream (Peter Robinson) - All: ACPI: De-dupe the ACPI options that are the same across ark/fedora on x86/arm (Peter Robinson) - Enable the vkms module in Fedora (Jeremy Cline) - Fedora: arm updates for 5.11 and general cross Fedora cleanups (Peter Robinson) - Add gcc-c++ to BuildRequires (Justin M. Forbes) - Update CONFIG_KASAN_HW_TAGS (Justin M. Forbes) - fedora: arm: move generic power off/reset to all arm (Peter Robinson) - fedora: ARMv7: build in DEVFREQ_GOV_SIMPLE_ONDEMAND until I work out why it's changed (Peter Robinson) - fedora: cleanup joystick_adc (Peter Robinson) - fedora: update some display options (Peter Robinson) - fedora: arm: enable TI PRU options (Peter Robinson) - fedora: arm: minor exynos plaform updates (Peter Robinson) - arm: SoC: disable Toshiba Visconti SoC (Peter Robinson) - common: disable ARCH_BCM4908 (NFC) (Peter Robinson) - fedora: minor arm config updates (Peter Robinson) - fedora: enable Tegra 234 SoC (Peter Robinson) - fedora: arm: enable new Hikey 3xx options (Peter Robinson) - Fedora: USB updates (Peter Robinson) - fedora: enable the GNSS receiver subsystem (Peter Robinson) - Remove POWER_AVS as no longer upstream (Peter Robinson) - Cleanup RESET_RASPBERRYPI (Peter Robinson) - Cleanup GPIO_CDEV_V1 options. (Peter Robinson) - fedora: arm crypto updates (Peter Robinson) - CONFIG_KASAN_HW_TAGS for aarch64 (Justin M. Forbes) - Fedora: cleanup PCMCIA configs, move to x86 (Peter Robinson) - New configs in drivers/rtc (Fedora Kernel Team) - redhat/configs: Enable CONFIG_GCC_PLUGIN_STRUCTLEAK_BYREF_ALL (Josh Poimboeuf) [1856176] - redhat/configs: Enable CONFIG_GCC_PLUGIN_STRUCTLEAK (Josh Poimboeuf) [1856176] - redhat/configs: Enable CONFIG_GCC_PLUGINS on ARK (Josh Poimboeuf) [1856176] - redhat/configs: Enable CONFIG_KASAN on Fedora (Josh Poimboeuf) [1856176] - New configs in init/Kconfig (Fedora Kernel Team) - build_configs.sh: Fix syntax flagged by shellcheck (Ben Crocker) - genspec.sh: Fix syntax flagged by shellcheck (Ben Crocker) - mod-blacklist.sh: Fix syntax flagged by shellcheck (Ben Crocker) - Enable Speakup accessibility driver (Justin M. Forbes) - New configs in init/Kconfig (Fedora Kernel Team) - Fix fedora config mismatch due to dep changes (Justin M. Forbes) - New configs in drivers/crypto (Jeremy Cline) - Remove duplicate ENERGY_MODEL configs (Peter Robinson) - This is selected by PCIE_QCOM so must match (Justin M. Forbes) - drop unused BACKLIGHT_GENERIC (Peter Robinson) - Remove cp instruction already handled in instruction below. (Paulo E. Castro) - Add all the dependencies gleaned from running `make prepare` on a bloated devel kernel. (Paulo E. Castro) - Add tools to path mangling script. (Paulo E. Castro) - Remove duplicate cp statement which is also not specific to x86. (Paulo E. Castro) - Correct orc_types failure whilst running `make prepare` https://bugzilla.redhat.com/show_bug.cgi?id=1882854 (Paulo E. Castro) - redhat: ark: enable CONFIG_IKHEADERS (Jiri Olsa) - Add missing '$' sign to (GIT) in redhat/Makefile (Augusto Caringi) - Remove filterdiff and use native git instead (Don Zickus) - New configs in net/sched (Justin M. Forbes) - New configs in drivers/mfd (CKI@GitLab) - New configs in drivers/mfd (Fedora Kernel Team) - New configs in drivers/firmware (Fedora Kernel Team) - Temporarily backout parallel xz script (Justin M. Forbes) - redhat: explicitly disable CONFIG_IMA_APPRAISE_SIGNED_INIT (Bruno Meneguele) - redhat: enable CONFIG_EVM_LOAD_X509 on ARK (Bruno Meneguele) - redhat: enable CONFIG_EVM_ATTR_FSUUID on ARK (Bruno Meneguele) - redhat: enable CONFIG_EVM in all arches and flavors (Bruno Meneguele) - redhat: enable CONFIG_IMA_LOAD_X509 on ARK (Bruno Meneguele) - redhat: set CONFIG_IMA_DEFAULT_HASH to SHA256 (Bruno Meneguele) - redhat: enable CONFIG_IMA_SECURE_AND_OR_TRUSTED_BOOT (Bruno Meneguele) - redhat: enable CONFIG_IMA_READ_POLICY on ARK (Bruno Meneguele) - redhat: set default IMA template for all ARK arches (Bruno Meneguele) - redhat: enable CONFIG_IMA_DEFAULT_HASH_SHA256 for all flavors (Bruno Meneguele) - redhat: disable CONFIG_IMA_DEFAULT_HASH_SHA1 (Bruno Meneguele) - redhat: enable CONFIG_IMA_ARCH_POLICY for ppc and x86 (Bruno Meneguele) - redhat: enable CONFIG_IMA_APPRAISE_MODSIG (Bruno Meneguele) - redhat: enable CONFIG_IMA_APPRAISE_BOOTPARAM (Bruno Meneguele) - redhat: enable CONFIG_IMA_APPRAISE (Bruno Meneguele) - redhat: enable CONFIG_INTEGRITY for aarch64 (Bruno Meneguele) - kernel: Update some missing KASAN/KCSAN options (Jeremy Linton) - kernel: Enable coresight on aarch64 (Jeremy Linton) - Update CONFIG_INET6_ESPINTCP (Justin Forbes) - New configs in net/ipv6 (Justin M. Forbes) - fedora: move CONFIG_RTC_NVMEM options from ark to common (Peter Robinson) - configs: Enable CONFIG_DEBUG_INFO_BTF (Don Zickus) - fedora: some minor arm audio config tweaks (Peter Robinson) - Ship xpad with default modules on Fedora and RHEL (Bastien Nocera) - Fedora: Only enable legacy serial/game port joysticks on x86 (Peter Robinson) - Fedora: Enable the options required for the Librem 5 Phone (Peter Robinson) - Fedora config update (Justin M. Forbes) - Fedora config change because CONFIG_FSL_DPAA2_ETH now selects CONFIG_FSL_XGMAC_MDIO (Justin M. Forbes) - redhat: generic enable CONFIG_INET_MPTCP_DIAG (Davide Caratti) - Fedora config update (Justin M. Forbes) - Enable NANDSIM for Fedora (Justin M. Forbes) - Re-enable CONFIG_ACPI_TABLE_UPGRADE for Fedora since upstream disables this if secureboot is active (Justin M. Forbes) - Ath11k related config updates (Justin M. Forbes) - Fedora config updates for ath11k (Justin M. Forbes) - Turn on ATH11K for Fedora (Justin M. Forbes) - redhat: enable CONFIG_INTEL_IOMMU_SVM (Jerry Snitselaar) - More Fedora config fixes (Justin M. Forbes) - Fedora 5.10 config updates (Justin M. Forbes) - Fedora 5.10 configs round 1 (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - Allow kernel-tools to build without selftests (Don Zickus) - Allow building of kernel-tools standalone (Don Zickus) - redhat: ark: disable CONFIG_NET_ACT_CTINFO (Davide Caratti) - redhat: ark: disable CONFIG_NET_SCH_TEQL (Davide Caratti) - redhat: ark: disable CONFIG_NET_SCH_SFB (Davide Caratti) - redhat: ark: disable CONFIG_NET_SCH_QFQ (Davide Caratti) - redhat: ark: disable CONFIG_NET_SCH_PLUG (Davide Caratti) - redhat: ark: disable CONFIG_NET_SCH_PIE (Davide Caratti) - redhat: ark: disable CONFIG_NET_SCH_HHF (Davide Caratti) - redhat: ark: disable CONFIG_NET_SCH_DSMARK (Davide Caratti) - redhat: ark: disable CONFIG_NET_SCH_DRR (Davide Caratti) - redhat: ark: disable CONFIG_NET_SCH_CODEL (Davide Caratti) - redhat: ark: disable CONFIG_NET_SCH_CHOKE (Davide Caratti) - redhat: ark: disable CONFIG_NET_SCH_CBQ (Davide Caratti) - redhat: ark: disable CONFIG_NET_SCH_ATM (Davide Caratti) - redhat: ark: disable CONFIG_NET_EMATCH and sub-targets (Davide Caratti) - redhat: ark: disable CONFIG_NET_CLS_TCINDEX (Davide Caratti) - redhat: ark: disable CONFIG_NET_CLS_RSVP6 (Davide Caratti) - redhat: ark: disable CONFIG_NET_CLS_RSVP (Davide Caratti) - redhat: ark: disable CONFIG_NET_CLS_ROUTE4 (Davide Caratti) - redhat: ark: disable CONFIG_NET_CLS_BASIC (Davide Caratti) - redhat: ark: disable CONFIG_NET_ACT_SKBMOD (Davide Caratti) - redhat: ark: disable CONFIG_NET_ACT_SIMP (Davide Caratti) - redhat: ark: disable CONFIG_NET_ACT_NAT (Davide Caratti) - arm64/defconfig: Enable CONFIG_KEXEC_FILE (Bhupesh Sharma) [1821565] - redhat/configs: Cleanup CONFIG_CRYPTO_SHA512 (Prarit Bhargava) - New configs in drivers/mfd (Fedora Kernel Team) - Fix LTO issues with kernel-tools (Don Zickus) - Point pathfix to the new location for gen_compile_commands.py (Justin M. Forbes) - configs: Disable CONFIG_SECURITY_SELINUX_DISABLE (Ondrej Mosnacek) - [Automatic] Handle config dependency changes (Don Zickus) - configs/iommu: Add config comment to empty CONFIG_SUN50I_IOMMU file (Jerry Snitselaar) - New configs in kernel/trace (Fedora Kernel Team) - Fix Fedora config locations (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - configs: enable CONFIG_CRYPTO_CTS=y so cts(cbc(aes)) is available in FIPS mode (Vladis Dronov) [1855161] - Partial revert: Add master merge check (Don Zickus) - Update Maintainers doc to reflect workflow changes (Don Zickus) - WIP: redhat/docs: Update documentation for single branch workflow (Prarit Bhargava) - Add CONFIG_ARM64_MTE which is not picked up by the config scripts for some reason (Justin M. Forbes) - Disable Speakup synth DECEXT (Justin M. Forbes) - Enable Speakup for Fedora since it is out of staging (Justin M. Forbes) - Modify patchlist changelog output (Don Zickus) - process_configs.sh: Fix syntax flagged by shellcheck (Ben Crocker) - generate_all_configs.sh: Fix syntax flagged by shellcheck (Ben Crocker) - redhat/self-test: Initial commit (Ben Crocker) - arch/x86: Remove vendor specific CPU ID checks (Prarit Bhargava) - redhat: Replace hardware.redhat.com link in Unsupported message (Prarit Bhargava) [1810301] - x86: Fix compile issues with rh_check_supported() (Don Zickus) - KEYS: Make use of platform keyring for module signature verify (Robert Holmes) - Input: rmi4 - remove the need for artificial IRQ in case of HID (Benjamin Tissoires) - ARM: tegra: usb no reset (Peter Robinson) - arm: make CONFIG_HIGHPTE optional without CONFIG_EXPERT (Jon Masters) - redhat: rh_kabi: deduplication friendly structs (Jiri Benc) - redhat: rh_kabi add a comment with warning about RH_KABI_EXCLUDE usage (Jiri Benc) - redhat: rh_kabi: introduce RH_KABI_EXTEND_WITH_SIZE (Jiri Benc) - redhat: rh_kabi: Indirect EXTEND macros so nesting of other macros will resolve. (Don Dutile) - redhat: rh_kabi: Fix RH_KABI_SET_SIZE to use dereference operator (Tony Camuso) - redhat: rh_kabi: Add macros to size and extend structs (Prarit Bhargava) - Removing Obsolete hba pci-ids from rhel8 (Dick Kennedy) [1572321] - mptsas: pci-id table changes (Laura Abbott) - mptsas: Taint kernel if mptsas is loaded (Laura Abbott) - mptspi: pci-id table changes (Laura Abbott) - qla2xxx: Remove PCI IDs of deprecated adapter (Jeremy Cline) - be2iscsi: remove unsupported device IDs (Chris Leech) [1574502 1598366] - mptspi: Taint kernel if mptspi is loaded (Laura Abbott) - hpsa: remove old cciss-based smartarray pci ids (Joseph Szczypek) [1471185] - qla4xxx: Remove deprecated PCI IDs from RHEL 8 (Chad Dupuis) [1518874] - aacraid: Remove depreciated device and vendor PCI id's (Raghava Aditya Renukunta) [1495307] - megaraid_sas: remove deprecated pci-ids (Tomas Henzl) [1509329] - mpt*: remove certain deprecated pci-ids (Jeremy Cline) - kernel: add SUPPORT_REMOVED kernel taint (Tomas Henzl) [1602033] - Rename RH_DISABLE_DEPRECATED to RHEL_DIFFERENCES (Don Zickus) - s390: Lock down the kernel when the IPL secure flag is set (Jeremy Cline) - efi: Lock down the kernel if booted in secure boot mode (David Howells) - efi: Add an EFI_SECURE_BOOT flag to indicate secure boot mode (David Howells) - security: lockdown: expose a hook to lock the kernel down (Jeremy Cline) - Make get_cert_list() use efi_status_to_str() to print error messages. (Peter Jones) - Add efi_status_to_str() and rework efi_status_to_err(). (Peter Jones) - Add support for deprecating processors (Laura Abbott) [1565717 1595918 1609604 1610493] - arm: aarch64: Drop the EXPERT setting from ARM64_FORCE_52BIT (Jeremy Cline) - iommu/arm-smmu: workaround DMA mode issues (Laura Abbott) - rh_kabi: introduce RH_KABI_EXCLUDE (Jakub Racek) [1652256] - ipmi: do not configure ipmi for HPE m400 (Laura Abbott) [1670017] - kABI: Add generic kABI macros to use for kABI workarounds (Myron Stowe) [1546831] - add pci_hw_vendor_status() (Maurizio Lombardi) [1590829] - ahci: thunderx2: Fix for errata that affects stop engine (Robert Richter) [1563590] - Vulcan: AHCI PCI bar fix for Broadcom Vulcan early silicon (Robert Richter) [1563590] - bpf: set unprivileged_bpf_disabled to 1 by default, add a boot parameter (Eugene Syromiatnikov) [1561171] - add Red Hat-specific taint flags (Eugene Syromiatnikov) [1559877] - tags.sh: Ignore redhat/rpm (Jeremy Cline) - put RHEL info into generated headers (Laura Abbott) [1663728] - aarch64: acpi scan: Fix regression related to X-Gene UARTs (Mark Salter) [1519554] - ACPI / irq: Workaround firmware issue on X-Gene based m400 (Mark Salter) [1519554] - modules: add rhelversion MODULE_INFO tag (Laura Abbott) - ACPI: APEI: arm64: Ignore broken HPE moonshot APEI support (Al Stone) [1518076] - Add Red Hat tainting (Laura Abbott) [1565704 1652266] - Introduce CONFIG_RH_DISABLE_DEPRECATED (Laura Abbott) - Stop merging ark-patches for release (Don Zickus) - Fix path location for ark-update-configs.sh (Don Zickus) - Combine Red Hat patches into single patch (Don Zickus) - New configs in drivers/misc (Jeremy Cline) - New configs in drivers/net/wireless (Justin M. Forbes) - New configs in drivers/phy (Fedora Kernel Team) - New configs in drivers/tty (Fedora Kernel Team) - Set SquashFS decompression options for all flavors to match RHEL (Bohdan Khomutskyi) - configs: Enable CONFIG_ENERGY_MODEL (Phil Auld) - New configs in drivers/pinctrl (Fedora Kernel Team) - Update CONFIG_THERMAL_NETLINK (Justin Forbes) - Separate merge-upstream and release stages (Don Zickus) - Re-enable CONFIG_IR_SERIAL on Fedora (Prarit Bhargava) - Create Patchlist.changelog file (Don Zickus) - Filter out upstream commits from changelog (Don Zickus) - Merge Upstream script fixes (Don Zickus) - kernel.spec: Remove kernel-keys directory on rpm erase (Prarit Bhargava) - Add mlx5_vdpa to module filter for Fedora (Justin M. Forbes) - Add python3-sphinx_rtd_theme buildreq for docs (Justin M. Forbes) - redhat/configs/process_configs.sh: Remove *.config.orig files (Prarit Bhargava) - redhat/configs/process_configs.sh: Add process_configs_known_broken flag (Prarit Bhargava) - redhat/Makefile: Fix '*-configs' targets (Prarit Bhargava) - dist-merge-upstream: Checkout known branch for ci scripts (Don Zickus) - kernel.spec: don't override upstream compiler flags for ppc64le (Dan Horák) - Fedora config updates (Justin M. Forbes) - Fedora confi gupdate (Justin M. Forbes) - mod-sign.sh: Fix syntax flagged by shellcheck (Ben Crocker) - Swap how ark-latest is built (Don Zickus) - Add extra version bump to os-build branch (Don Zickus) - dist-release: Avoid needless version bump. (Don Zickus) - Add dist-fedora-release target (Don Zickus) - Remove redundant code in dist-release (Don Zickus) - Makefile.common rename TAG to _TAG (Don Zickus) - Fedora config change (Justin M. Forbes) - Fedora filter update (Justin M. Forbes) - Config update for Fedora (Justin M. Forbes) - enable PROTECTED_VIRTUALIZATION_GUEST for all s390x kernels (Dan Horák) - redhat: ark: enable CONFIG_NET_SCH_TAPRIO (Davide Caratti) - redhat: ark: enable CONFIG_NET_SCH_ETF (Davide Caratti) - More Fedora config updates (Justin M. Forbes) - New config deps (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - First half of config updates for Fedora (Justin M. Forbes) - Updates for Fedora arm architectures for the 5.9 window (Peter Robinson) - Merge 5.9 config changes from Peter Robinson (Justin M. Forbes) - Add config options that only show up when we prep on arm (Justin M. Forbes) - Config updates for Fedora (Justin M. Forbes) - fedora: enable enery model (Peter Robinson) - Use the configs/generic config for SND_HDA_INTEL everywhere (Peter Robinson) - Enable ZSTD compression algorithm on all kernels (Peter Robinson) - Enable ARM_SMCCC_SOC_ID on all aarch64 kernels (Peter Robinson) - iio: enable LTR-559 light and proximity sensor (Peter Robinson) - iio: chemical: enable some popular chemical and partical sensors (Peter Robinson) - More mismatches (Justin M. Forbes) - Fedora config change due to deps (Justin M. Forbes) - CONFIG_SND_SOC_MAX98390 is now selected by SND_SOC_INTEL_DA7219_MAX98357A_GENERIC (Justin M. Forbes) - Config change required for build part 2 (Justin M. Forbes) - Config change required for build (Justin M. Forbes) - Fedora config update (Justin M. Forbes) - Add ability to sync upstream through Makefile (Don Zickus) - Add master merge check (Don Zickus) - Replace hardcoded values 'os-build' and project id with variables (Don Zickus) - redhat/Makefile.common: Fix MARKER (Prarit Bhargava) - gitattributes: Remove unnecesary export restrictions (Prarit Bhargava) - Add new certs for dual signing with boothole (Justin M. Forbes) - Update secureboot signing for dual keys (Justin M. Forbes) - fedora: enable LEDS_SGM3140 for arm configs (Peter Robinson) - Enable CONFIG_DM_VERITY_VERIFY_ROOTHASH_SIG (Justin M. Forbes) - redhat/configs: Fix common CONFIGs (Prarit Bhargava) - redhat/configs: General CONFIG cleanups (Prarit Bhargava) - redhat/configs: Update & generalize evaluate_configs (Prarit Bhargava) - fedora: arm: Update some meson config options (Peter Robinson) - redhat/docs: Add Fedora RPM tagging date (Prarit Bhargava) - Update config for renamed panel driver. (Peter Robinson) - Enable SERIAL_SC16IS7XX for SPI interfaces (Peter Robinson) - s390x-zfcpdump: Handle missing Module.symvers file (Don Zickus) - Fedora config updates (Justin M. Forbes) - redhat/configs: Add .tmp files to .gitignore (Prarit Bhargava) - disable uncommon TCP congestion control algorithms (Davide Caratti) - Add new bpf man pages (Justin M. Forbes) - Add default option for CONFIG_ARM64_BTI_KERNEL to pending-common so that eln kernels build (Justin M. Forbes) - redhat/Makefile: Add fedora-configs and rh-configs make targets (Prarit Bhargava) - redhat/configs: Use SHA512 for module signing (Prarit Bhargava) - genspec.sh: 'touch' empty Patchlist file for single tarball (Don Zickus) - Fedora config update for rc1 (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - redhat/Makefile.common: fix RPMKSUBLEVEL condition (Ondrej Mosnacek) - redhat/Makefile: silence KABI tar output (Ondrej Mosnacek) - One more Fedora config update (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - Fix PATCHLEVEL for merge window (Justin M. Forbes) - Change ark CONFIG_COMMON_CLK to yes, it is selected already by other options (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - More module filtering for Fedora (Justin M. Forbes) - Update filters for rnbd in Fedora (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - Fix up module filtering for 5.8 (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - More Fedora config work (Justin M. Forbes) - RTW88BE and CE have been extracted to their own modules (Justin M. Forbes) - Set CONFIG_BLK_INLINE_ENCRYPTION_FALLBACK for Fedora (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - Arm64 Use Branch Target Identification for kernel (Justin M. Forbes) - Change value of CONFIG_SECURITY_SELINUX_CHECKREQPROT_VALUE (Justin M. Forbes) - Fedora config updates (Justin M. Forbes) - Fix configs for Fedora (Justin M. Forbes) - Add zero-commit to format-patch options (Justin M. Forbes) - Copy Makefile.rhelver as a source file rather than a patch (Jeremy Cline) - Move the sed to clear the patch templating outside of conditionals (Justin M. Forbes) - Match template format in kernel.spec.template (Justin M. Forbes) - Break out the Patches into individual files for dist-git (Justin M. Forbes) - Break the Red Hat patch into individual commits (Jeremy Cline) - Fix update_scripts.sh unselective pattern sub (David Howells) - Add cec to the filter overrides (Justin M. Forbes) - Add overrides to filter-modules.sh (Justin M. Forbes) - redhat/configs: Enable CONFIG_SMC91X and disable CONFIG_SMC911X (Prarit Bhargava) [1722136] - Include bpftool-struct_ops man page in the bpftool package (Jeremy Cline) - Add sharedbuffer_configuration.py to the pathfix.py script (Jeremy Cline) - Use __make macro instead of make (Tom Stellard) - Sign off generated configuration patches (Jeremy Cline) - Drop the static path configuration for the Sphinx docs (Jeremy Cline) - redhat: Add dummy-module kernel module (Prarit Bhargava) - redhat: enable CONFIG_LWTUNNEL_BPF (Jiri Benc) - Remove typoed config file aarch64CONFIG_SM_GCC_8150 (Justin M. Forbes) - Add Documentation back to kernel-devel as it has Kconfig now (Justin M. Forbes) - Copy distro files rather than moving them (Jeremy Cline) - kernel.spec: fix 'make scripts' for kernel-devel package (Brian Masney) - Makefile: correct help text for dist-cross--rpms (Brian Masney) - redhat/Makefile: Fix RHEL8 python warning (Prarit Bhargava) - redhat: Change Makefile target names to dist- (Prarit Bhargava) - configs: Disable Serial IR driver (Prarit Bhargava) - Fix "multiple %files for package kernel-tools" (Pablo Greco) - Introduce a Sphinx documentation project (Jeremy Cline) - Build ARK against ELN (Don Zickus) - Drop the requirement to have a remote called linus (Jeremy Cline) - Rename 'internal' branch to 'os-build' (Don Zickus) - Only include open merge requests with "Include in Releases" label (Jeremy Cline) - Package gpio-watch in kernel-tools (Jeremy Cline) - Exit non-zero if the tag already exists for a release (Jeremy Cline) - Adjust the changelog update script to not push anything (Jeremy Cline) - Drop --target noarch from the rh-rpms make target (Jeremy Cline) - Add a script to generate release tags and branches (Jeremy Cline) - Set CONFIG_VDPA for fedora (Justin M. Forbes) - Add a README to the dist-git repository (Jeremy Cline) - Provide defaults in ark-rebase-patches.sh (Jeremy Cline) - Default ark-rebase-patches.sh to not report issues (Jeremy Cline) - Drop DIST from release commits and tags (Jeremy Cline) - Place the buildid before the dist in the release (Jeremy Cline) - Sync up with Fedora arm configuration prior to merging (Jeremy Cline) - Disable CONFIG_PROTECTED_VIRTUALIZATION_GUEST for zfcpdump (Jeremy Cline) - Add RHMAINTAINERS file and supporting conf (Don Zickus) - Add a script to test if all commits are signed off (Jeremy Cline) - Fix make rh-configs-arch (Don Zickus) - Drop RH_FEDORA in favor of the now-merged RHEL_DIFFERENCES (Jeremy Cline) - Sync up Fedora configs from the first week of the merge window (Jeremy Cline) - Migrate blacklisting floppy.ko to mod-blacklist.sh (Don Zickus) - kernel packaging: Combine mod-blacklist.sh and mod-extra-blacklist.sh (Don Zickus) - kernel packaging: Fix extra namespace collision (Don Zickus) - mod-extra.sh: Rename to mod-blacklist.sh (Don Zickus) - mod-extra.sh: Make file generic (Don Zickus) - Fix a painfully obvious YAML syntax error in .gitlab-ci.yml (Jeremy Cline) - Add in armv7hl kernel header support (Don Zickus) - Disable all BuildKernel commands when only building headers (Don Zickus) - Drop any gitlab-ci patches from ark-patches (Jeremy Cline) - Build the srpm for internal branch CI using the vanilla tree (Jeremy Cline) - Pull in the latest ARM configurations for Fedora (Jeremy Cline) - Fix xz memory usage issue (Neil Horman) - Use ark-latest instead of master for update script (Jeremy Cline) - Move the CI jobs back into the ARK repository (Jeremy Cline) - Sync up ARK's Fedora config with the dist-git repository (Jeremy Cline) - Pull in the latest configuration changes from Fedora (Jeremy Cline) - configs: enable CONFIG_NET_SCH_CBS (Marcelo Ricardo Leitner) - Drop configuration options in fedora/ that no longer exist (Jeremy Cline) - Set RH_FEDORA for ARK and Fedora (Jeremy Cline) - redhat/kernel.spec: Include the release in the kernel COPYING file (Jeremy Cline) - redhat/kernel.spec: add scripts/jobserver-exec to py3_shbang_opts list (Jeremy Cline) - redhat/kernel.spec: package bpftool-gen man page (Jeremy Cline) - distgit-changelog: handle multiple y-stream BZ numbers (Bruno Meneguele) - redhat/kernel.spec: remove all inline comments (Bruno Meneguele) - redhat/genspec: awk unknown whitespace regex pattern (Bruno Meneguele) - Improve the readability of gen_config_patches.sh (Jeremy Cline) - Fix some awkward edge cases in gen_config_patches.sh (Jeremy Cline) - Update the CI environment to use Fedora 31 (Jeremy Cline) - redhat: drop whitespace from with_gcov macro (Jan Stancek) - configs: Enable CONFIG_KEY_DH_OPERATIONS on ARK (Ondrej Mosnacek) - configs: Adjust CONFIG_MPLS_ROUTING and CONFIG_MPLS_IPTUNNEL (Laura Abbott) - New configs in lib/crypto (Jeremy Cline) - New configs in drivers/char (Jeremy Cline) - Turn on BLAKE2B for Fedora (Jeremy Cline) - kernel.spec.template: Clean up stray *.h.s files (Laura Abbott) - Build the SRPM in the CI job (Jeremy Cline) - New configs in net/tls (Jeremy Cline) - New configs in net/tipc (Jeremy Cline) - New configs in lib/kunit (Jeremy Cline) - Fix up released_kernel case (Laura Abbott) - New configs in lib/Kconfig.debug (Jeremy Cline) - New configs in drivers/ptp (Jeremy Cline) - New configs in drivers/nvme (Jeremy Cline) - New configs in drivers/net/phy (Jeremy Cline) - New configs in arch/arm64 (Jeremy Cline) - New configs in drivers/crypto (Jeremy Cline) - New configs in crypto/Kconfig (Jeremy Cline) - Add label so the Gitlab to email bridge ignores the changelog (Jeremy Cline) - Temporarily switch TUNE_DEFAULT to y (Jeremy Cline) - Run config test for merge requests and internal (Jeremy Cline) - Add missing licensedir line (Laura Abbott) - redhat/scripts: Remove redhat/scripts/rh_get_maintainer.pl (Prarit Bhargava) - configs: Take CONFIG_DEFAULT_MMAP_MIN_ADDR from Fedra (Laura Abbott) - configs: Turn off ISDN (Laura Abbott) - Add a script to generate configuration patches (Laura Abbott) - Introduce rh-configs-commit (Laura Abbott) - kernel-packaging: Remove kernel files from kernel-modules-extra package (Prarit Bhargava) - configs: Enable CONFIG_DEBUG_WX (Laura Abbott) - configs: Disable wireless USB (Laura Abbott) - Clean up some temporary config files (Laura Abbott) - configs: New config in drivers/gpu for v5.4-rc1 (Jeremy Cline) - configs: New config in arch/powerpc for v5.4-rc1 (Jeremy Cline) - configs: New config in crypto for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/usb for v5.4-rc1 (Jeremy Cline) - AUTOMATIC: New configs (Jeremy Cline) - Skip ksamples for bpf, they are broken (Jeremy Cline) - configs: New config in fs/erofs for v5.4-rc1 (Jeremy Cline) - configs: New config in mm for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/md for v5.4-rc1 (Jeremy Cline) - configs: New config in init for v5.4-rc1 (Jeremy Cline) - configs: New config in fs/fuse for v5.4-rc1 (Jeremy Cline) - merge.pl: Avoid comments but do not skip them (Don Zickus) - configs: New config in drivers/net/ethernet/pensando for v5.4-rc1 (Jeremy Cline) - Update a comment about what released kernel means (Laura Abbott) - Provide both Fedora and RHEL files in the SRPM (Laura Abbott) - kernel.spec.template: Trim EXTRAVERSION in the Makefile (Laura Abbott) - kernel.spec.template: Add macros for building with nopatches (Laura Abbott) - kernel.spec.template: Add some macros for Fedora differences (Laura Abbott) - kernel.spec.template: Consolodate the options (Laura Abbott) - configs: Add pending direcory to Fedora (Laura Abbott) - kernel.spec.template: Don't run hardlink if rpm-ostree is in use (Laura Abbott) - configs: New config in net/can for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/net/phy for v5.4-rc1 (Jeremy Cline) - configs: Increase x86_64 NR_UARTS to 64 (Prarit Bhargava) [1730649] - configs: turn on ARM64_FORCE_52BIT for debug builds (Jeremy Cline) - kernel.spec.template: Tweak the python3 mangling (Laura Abbott) - kernel.spec.template: Add --with verbose option (Laura Abbott) - kernel.spec.template: Switch to using %install instead of %__install (Laura Abbott) - kernel.spec.template: Make the kernel.org URL https (Laura Abbott) - kernel.spec.template: Update message about secure boot signing (Laura Abbott) - kernel.spec.template: Move some with flags definitions up (Laura Abbott) - kernel.spec.template: Update some BuildRequires (Laura Abbott) - kernel.spec.template: Get rid of %clean (Laura Abbott) - configs: New config in drivers/char for v5.4-rc1 (Jeremy Cline) - configs: New config in net/sched for v5.4-rc1 (Jeremy Cline) - configs: New config in lib for v5.4-rc1 (Jeremy Cline) - configs: New config in fs/verity for v5.4-rc1 (Jeremy Cline) - configs: New config in arch/aarch64 for v5.4-rc4 (Jeremy Cline) - configs: New config in arch/arm64 for v5.4-rc1 (Jeremy Cline) - Flip off CONFIG_ARM64_VA_BITS_52 so the bundle that turns it on applies (Jeremy Cline) - New configuration options for v5.4-rc4 (Jeremy Cline) - Correctly name tarball for single tarball builds (Laura Abbott) - configs: New config in drivers/pci for v5.4-rc1 (Jeremy Cline) - Allow overriding the dist tag on the command line (Laura Abbott) - Allow scratch branch target to be overridden (Laura Abbott) - Remove long dead BUILD_DEFAULT_TARGET (Laura Abbott) - Amend the changelog when rebasing (Laura Abbott) - configs: New config in drivers/platform for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/pinctrl for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/net/wireless for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/net/ethernet/mellanox for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/net/can for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/hid for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/dma-buf for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/crypto for v5.4-rc1 (Jeremy Cline) - configs: New config in arch/s390 for v5.4-rc1 (Jeremy Cline) - configs: New config in block for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/cpuidle for v5.4-rc1 (Jeremy Cline) - redhat: configs: Split CONFIG_CRYPTO_SHA512 (Laura Abbott) - redhat: Set Fedora options (Laura Abbott) - Set CRYPTO_SHA3_*_S390 to builtin on zfcpdump (Jeremy Cline) - configs: New config in drivers/edac for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/firmware for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/hwmon for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/iio for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/mmc for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/tty for v5.4-rc1 (Jeremy Cline) - configs: New config in arch/s390 for v5.4-rc1 (Jeremy Cline) - configs: New config in drivers/bus for v5.4-rc1 (Jeremy Cline) - Add option to allow mismatched configs on the command line (Laura Abbott) - configs: New config in drivers/crypto for v5.4-rc1 (Jeremy Cline) - configs: New config in sound/pci for v5.4-rc1 (Jeremy Cline) - configs: New config in sound/soc for v5.4-rc1 (Jeremy Cline) - gitlab: Add CI job for packaging scripts (Major Hayden) - Speed up CI with CKI image (Major Hayden) - Disable e1000 driver in ARK (Neil Horman) - configs: Fix the pending default for CONFIG_ARM64_VA_BITS_52 (Jeremy Cline) - configs: Turn on OPTIMIZE_INLINING for everything (Jeremy Cline) - configs: Set valid pending defaults for CRYPTO_ESSIV (Jeremy Cline) - Add an initial CI configuration for the internal branch (Jeremy Cline) - New drop of configuration options for v5.4-rc1 (Jeremy Cline) - New drop of configuration options for v5.4-rc1 (Jeremy Cline) - Pull the RHEL version defines out of the Makefile (Jeremy Cline) - Sync up the ARK build scripts (Jeremy Cline) - Sync up the Fedora Rawhide configs (Jeremy Cline) - Sync up the ARK config files (Jeremy Cline) - configs: Adjust CONFIG_FORCE_MAX_ZONEORDER for Fedora (Laura Abbott) - configs: Add README for some other arches (Laura Abbott) - configs: Sync up Fedora configs (Laura Abbott) - [initial commit] Add structure for building with git (Laura Abbott) - [initial commit] Add Red Hat variables in the top level makefile (Laura Abbott) - [initial commit] Red Hat gitignore and attributes (Laura Abbott) - [initial commit] Add changelog (Laura Abbott) - [initial commit] Add makefile (Laura Abbott) - [initial commit] Add files for generating the kernel.spec (Laura Abbott) - [initial commit] Add rpm directory (Laura Abbott) - [initial commit] Add files for packaging (Laura Abbott) - [initial commit] Add kabi files (Laura Abbott) - [initial commit] Add scripts (Laura Abbott) - [initial commit] Add configs (Laura Abbott) - [initial commit] Add Makefiles (Laura Abbott) - Linux v6.13.0-0.rc0.158f238aa69d/bin/sh/bin/sh  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^6.13.8-400.asahi.el96.13.8-400.asahi.el96.13.8-400.asahi.el9++16k6.13.8-400.asahi.el96.13.8-400.asahi.el96.13.8-400.asahi.el9++16k6.13.8-400.asahi.el9.aarch64++16k     !!""!!#$!!%%%%%!!!!&!!!!''!!!!!!!!!!!!!(!!!!!!!!!!!!!!!!!! ))))*++,,,-.////////000000//////111111////////////223333333333244255555566766666666889:9;;;<<<=>>>????>@@=AAAAA==B=CCCCC==D=EEEEEEEEEEEEEEEEEEEEE=FFGFFHFFFIIFFJFKKKFLLFMMFNNFOOFPPPPFQQF=R=S==TTTT==UUUUUUUUVVVUUUUUUUUUU=WXXYYYYYYYYYYYYZZ[[[[\\[[][^^__________`_aa^bbbbbb^ccccccdceecffcgccchhhhciiiccjjckkkkkllkccmccnnnncoocpcqqqcrrrrrrrrrrrrrrccssssttscuuvuuuccwcxcyccczccc{c||||c}}ccccccccc~cccccc^^^^^^^^^^^^^^^^^^^^rxrpc-blacklist.confarcharm64cryptocryptoasymmetric_keysasync_txdriversaccelqaicaccessibilityspeakupacpiapeinfitataauxdisplaybaseregmaptestbcmablockaoedrbdnull_blkrnbdzrambluetoothbusmhihostcdxcontrollercharhw_randomipmitpmxillybusclkbcmhisiliconimxkeystoneqcomxilinxcountercpufreqcryptoallwinnersun4i-sssun8i-cesun8i-sscaamcaviumcptnitroxzipccpchelsiohisiliconhpretrnginside-secureintelqatqat_420xxqat_4xxxqat_c3xxxqat_c3xxxvfqat_c62xqat_c62xvfqat_commonqat_dh895xccqat_dh895xccvfmarvellcesaocteontxocteontx2qcerockchiptegravirtioxilinxcxlcoredaxhmemdevfreqeventdmaamdqdmadwdw-axi-dmacdw-edmafsl-dpaa2-qdmaqcomshtixilinxedacextconfirmwarearm_ffaarm_scmitransportsvendorsimxcirrusefistmmtestimxfpgagnssgpiogpudrmadpamdamdgpuamdxcpapplearmdisplaykomedaastbridgeadv7511analogixcadenceimxsynopsysdisplayetnavivgudhisiliconkirinhypervi2cimaginationimxdcsslcdclimamesonmgag200msmmxsfbnouveaupanelpanfrostpanthorpl111qxlradeonrenesasrz-durockchipschedulersolomonsun4itegrateststidsstinyttmudlv3dvc4vgemvirtiovkmsvmwgfxxexlnxhost1xhiddockchannel-hidi2c-hidspi-hidsurface-hidhtehvhwmonpmbushwspinlockhwtracingcoresightstmi2calgosbussesmuxesi3cmastermipi-i3c-hciiioacceladcaddacafeamplifiersbufferchemicalcommoncros_ec_sensorshid-sensorsinv_sensorsms_sensorsscmi_sensorsst_sensorsdacfrequencygyrohealthhumidityimubmi160bmi270bno055inv_icm42600inv_mpu6050st_lsm6dsxlightmagnetometermultiplexerorientationpositionpotentiometerpotentiostatpressureproximitytemperaturetesttriggerinfinibandcorehwcxgb4efaerdmairdmamanamlx4mlx5mthcaocrdmaqedrswrxesiwulpipoibiserisertrtrssrpsrptinputgameportjoystickiforcekeyboardmiscmousermi4seriotabletteststouchscreeninterconnectimxqcomiommuarmarm-smmu-v3iommufdirqchipledsflashrgbtriggermailboxmdbcachedm-vdopersistent-datamediaceccorei2cplatformcec-gpiocros-ecmesontegrausbpulse8rainshadowcommonb2c2saa7146sianov4l2-tpgvideobuf2dvb-coredvb-frontendsdrx39xyji2cadv748xccscx25840et8ek8s5c73m3mcmmcsianopcib2c2bt8xxcx18cx23885cx88ddbridgedm1105intelivtvmantisnetup_unidvbngenepluto2pt1saa7134saa7146saa7164smipciesolo6x10ttpcitw686xplatformallegro-dvtamlogicmeson-ge2damphionappleispbroadcomcadencechips-mediacodawave5imaginationnvidiategra-vdenxpdw100imx-jpegimx8-isiqcomcamssvenusraspberrypipisp_berp1-cferenesasrzg2l-cruvsp1rockchiprgarkisp1sunxisun4i-csisun6i-csisun8i-disun8i-rotateticalj721e-csi2rxverisiliconradiosi470xrckeymapsspitest-driversvicodecvimcvislvividtunersusbas102au0828cx231xxdvb-usbdvb-usb-v2em28xxgo7007gspcagl860m5602stv06xxhdpvrpvrusb2pwcs2255sianostk1160ttusb-budgetttusb-decusbtvuvcv4l2-corememorytegramemstickcorehostmfdmiscaltera-staplbcm-vkcardreadercb710echoeepromkebalis3lv02dmchp_pci1xxxxpvpanicuaccevmw_vmcimmccorehostmtdchipsdevicesmapsnandrawspiparsersspi-norcontrollersubimuxnetbondingcanctucanfddevflexcanifi_canfdm_canpeak_canfdrcarrockchipslcanspimcp251xfdusbkvaser_usbpeak_usbdsab53hirschmannmv88e6xxxqcarealtekxrs700xethernet8390adiagerealteonalteraamazonenaamdpds_corexgbeapmxgenexgene-v2aquantiaatlanticarcasixatherosalxatl1catl1eatlxbroadcombnx2xbnxtgenetcadencecaviumcommonthunderchelsiocxgbcxgb3cxgb4cxgb4vfinline_cryptoch_ipsecch_ktlslibcxgbdlinkemulexbenetenglederfreescaledpaadpaa2enetcfmanfungiblefuncorefunethgooglegvehisiliconhibmcgehnshns3intele1000e1000efm10ki40eiavficeidpfigbigbvfigcixgbeixgbevflibethlibielitexmarvellmvpp2octeon_epocteon_ep_vfocteontx2afnicpresteramellanoxmlx4mlx5coremlxbf_gigemlxfwmlxswmicrelmicrochiplan966xmicrosoftmanamyricommyri10genatsemineterionnetronomenfpnvidiapacketenginespensandoionicqlogicnetxenqedqedeqlcnicqualcommemacrmnetrdcrealtekrenesasrockersilansissmscsocionextstmicrostmmactehutitiicssgvertexcomviawangxunlibwxngbetxgbexilinxhamradiohypervieee802154ipaipvlanmctpmdionetdevsimpcsphyaquantiamediatekmsccqcompppslipteamthunderboltusbvmxnet3vxlanwireguardwirelessathar5523ath10kath11kath12kath5kath6klath9kcarl9170wcn36xxwil6210broadcomb43b43legacybrcm80211brcmfmacbcacywwccbrcmsmacbrcmutilinteliwlegacyiwlwifidvmmvmteststestsmarvelllibertas_tfmwifiexmediatekmt76mt7603mt7615mt76x0mt76x2mt7915mt7921mt7925mt7996mt7601uquantennaqtnfmacralinkrt2x00realtekrtl818xrtl8180rtl8187rtl8xxxurtlwifibtcoexistrtl8188eertl8192crtl8192certl8192drtl8192dertl8192durtl8192eertl8192sertl8723aertl8723bertl8723comrtl8821aertw88rtw89rsistcw1200tiwl1251wl12xxwl18xxwlcorevirtualzydaszd1211rwwwaniosmt7xxnfcmicroreadnfcmrvlnxp-ncipn533pn544st21nfcanvdimmnvmecommonhosttargetnvmemlayoutsofpcicontrollerhotplugpciepwrctrlswitchperfamlogicarm_cspmuphyallwinneramlogicapplecadencefreescalehisiliconmarvellqualcommrenesasrockchiptegratixilinxpinctrlcirrusqcomplatformapplearm64chromemellanoxsurfaceaggregatorpmdomainarmimxqcompowerresetsequencingsupplypowercapppsclientsptppwmrapidiodevicesswitchesregulatorremoteprocresetamlogichisiliconrpmsgrtcscsiarcmsrbe2iscsibnx2fcbnx2icsiostorcxgbicxgb3icxgb4idevice_handlerelxesas2rfcoelibfclibsaslpfcmegaraidmpi3mrmpt3sasmvsasqedfqediqla2xxxqla4xxxsmartpqisnicsym53c8xx_2slimbussocamlogicapplefsldpioimxnuvotonqcomrockchiptisoundwirespispmissbstagingmediamax96712mesonvdecrkvdecsunxicedrussun6i-isptegra-videortl8723bsvc04_servicesbcm2835-audiobcm2835-cameravchiq-mmaltargetiscsicxgbitloopbacktcm_fctcm_remoteteeopteetsteethermalbroadcomqcomrenesastegrattyserial8250jsmufscorehostuiousbatmcdns3chipideaclasscommoncoredwc2dwc3gadgetfunctionlegacyudccdns2hostimageisp1760miscsisusbvgamusbphyserialstoragetypecaltmodesmuxtcpmqcomtipducsiusbipvdpaifcvfmlx5octeon_eppdssolidrunvdpa_simvirtio_pcivfiocdxfsl-mcpcimlx5nvgrace-gpupdsqatvirtioplatformresetvhostvideobacklightvirtcocoarm-cca-guestnitro_enclavesvirtiow1mastersslaveswatchdogfs9pafsbcachefscachefilescephdlmecryptfserofsexfatext4f2fsfatfusegfs2hfshfsplusisofsjffs2jfslockdminixnetfsnfsblocklayoutfilelayoutflexfilelayoutnfs_commonnfsdnilfs2nlsntfs3orangefsoverlayfspstoreromfssmbclientcommonsquashfsubifsudfufsxfszonefskernelbpfpreloadlockingrcutimetracelibcryptokunitlz4mathtestsreed_solomonmmkfencenet6lowpan8028021q9pappletalkatmax25batman-advbluetoothbnephidprfcommbridgenetfiltercanj1939cephcoredns_resolverdsahandshakehsrieee8021546lowpanifeipv4netfilteripv6ilanetfilterkcmkeyl2tpllcmac80211testsmac802154mplsmptcpnetfilteripsetipvsnetromnfchcincinshopenvswitchpsampleqrtrrfkillroserxrpcschedsctpsmcsunrpcauth_gssxprtrdmatipctlsvmw_vsockwirelesstestsxdpxfrmsoundcoreossseqossdriversmpu401opl3vxhdaexti2cotherpciac97au88x0ca0106cs46xxctxfiechoaudioemu10k1hdaice1712korg1212lolalx6464esmixartnm256oxygenpcxhrriptiderme9652tridentvx222ymfpcisocadiapplebcmcodecsdwcfslgenericgooglehisiliconmesonqcomqdsp6renesasrockchipsofimxxtensasunxitegratixilinxsynthemuxusb6firebcd2000caiaqhifaceline6miscvirtiopartnerkafs.ko.xzrxrpc.ko.xz/etc/modprobe.d//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/arch//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/arch/arm64//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/crypto//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/accel//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/accessibility//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/acpi//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/base//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/block//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/bus//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/bus/mhi//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/cdx//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/char//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/clk//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/crypto//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/crypto/allwinner//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/crypto/cavium//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/crypto/hisilicon//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/crypto/intel//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/crypto/intel/qat//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/crypto/marvell//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/cxl//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/dax//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/devfreq//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/dma//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/dma/amd//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/firmware//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/firmware/arm_scmi//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/firmware/arm_scmi/vendors//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/firmware/efi//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/gpu//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/gpu/drm//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/gpu/drm/amd//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/gpu/drm/arm//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/gpu/drm/arm/display//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/gpu/drm/bridge//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/gpu/drm/hisilicon//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/gpu/drm/imx//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/gpu/drm/renesas//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/hid//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/hwmon//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/hwtracing//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/i2c//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/i3c//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/i3c/master//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/iio//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/iio/common//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/iio/imu//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/infiniband//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/infiniband/hw//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/infiniband/sw//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/infiniband/ulp//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/input//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/input/joystick//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/interconnect//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/iommu//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/iommu/arm//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/leds//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/md//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/media//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/cec//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/cec/platform//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/cec/usb//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/common//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/dvb-frontends//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/i2c//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/mmc//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/pci//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/platform//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/platform/amlogic//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/platform/apple//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/platform/chips-media//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/platform/nvidia//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/platform/nxp//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/platform/qcom//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/platform/raspberrypi//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/platform/renesas//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/platform/rockchip//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/platform/sunxi//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/platform/ti//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/radio//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/rc//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/test-drivers//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/usb//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/media/usb/gspca//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/memory//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/memstick//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/misc//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/mmc//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/mtd//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/mtd/nand//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/mtd/spi-nor//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/can//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/can/spi//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/can/usb//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/dsa//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/amazon//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/amd//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/apm//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/aquantia//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/atheros//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/broadcom//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/cavium//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/chelsio//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/chelsio/inline_crypto//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/emulex//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/freescale//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/fungible//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/google//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/hisilicon//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/intel//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/marvell//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/marvell/octeontx2//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/mellanox//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/mellanox/mlx5//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/microchip//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/microsoft//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/myricom//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/netronome//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/pensando//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/qlogic//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/qualcomm//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/stmicro//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/ti//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/ethernet/wangxun//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/phy//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless/ath//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless/broadcom//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless/broadcom/brcm80211//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless/broadcom/brcm80211/brcmfmac//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless/intel//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless/intel/iwlwifi//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless/intel/iwlwifi/mvm//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless/marvell//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless/mediatek//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless/mediatek/mt76//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless/quantenna//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless/ralink//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless/realtek//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless/realtek/rtl818x//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless/realtek/rtlwifi//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless/st//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless/ti//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wireless/zydas//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/net/wwan//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/nfc//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/nvme//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/nvmem//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/pci//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/perf//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/phy//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/pinctrl//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/platform//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/platform/surface//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/pmdomain//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/power//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/pps//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/rapidio//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/reset//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/scsi//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/scsi/cxgbi//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/soc//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/soc/fsl//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/staging//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/staging/media//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/staging/media/meson//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/staging/media/sunxi//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/staging/vc04_services//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/target//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/target/iscsi//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/tee//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/thermal//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/tty//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/tty/serial//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/ufs//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/usb//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/usb/gadget//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/usb/gadget/udc//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/usb/misc//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/usb/typec//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/usb/typec/tcpm//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/vdpa//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/vfio//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/vfio/pci//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/vfio/platform//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/video//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/virt//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/virt/coco//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/drivers/w1//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/fs//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/fs/nfs//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/fs/smb//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/kernel//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/kernel/bpf//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/lib//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/lib/math//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/mm//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/net//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/net/bluetooth//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/net/bridge//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/net/can//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/net/ieee802154//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/net/ipv4//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/net/ipv6//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/net/mac80211//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/net/netfilter//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/net/nfc//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/net/sunrpc//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/net/wireless//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/sound//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/sound/core//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/sound/core/seq//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/sound/drivers//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/sound/hda//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/sound/i2c//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/sound/pci//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/sound/soc//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/sound/soc/qcom//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/sound/soc/sof//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/sound/synth//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/kernel/sound/usb//lib/modules/6.13.8-400.asahi.el9.aarch64+16k//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/partner/fs/afs//lib/modules/6.13.8-400.asahi.el9.aarch64+16k/partner/net/rxrpc/-O2 -fexceptions -g -grecord-gcc-switches -pipe -Wall -Werror=format-security -Wp,-D_FORTIFY_SOURCE=2 -Wp,-D_GLIBCXX_ASSERTIONS -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -fstack-protector-strong -specs=/usr/lib/rpm/redhat/redhat-annobin-cc1 -fasynchronous-unwind-tables -fstack-clash-protectioncpioxz3Taarch64-redhat-linux-gnuASCII textdirectoryELF 64-bit LSB relocatable, ARM aarch64, version 1 (SYSV) (XZ compressed data)PP P P utf-891f8f2e406324fee5f46396e00f2e2bc81e7de35d6babe3f2cd8299aa56f0877b6640fd3442eefef297e20efc82be6241ab52b64e8f9590cd58d9154e5799818? 7zXZ И !t;] b2u Q{LZК7M9\X\nș%@t\-}b`e"NWgl`ZY|ئB{w=J|RB8p;Ȝěm%p}i]0!Ѹm3-/R{'_KBqGN:Ed4QFWܙ% q.\F8t=B/Ԩu;leyEěa!#{s[:-e⢘R^; v\Jb3ΓE@f]\jc,ƪ6a]f?//>nXA2VS]E_Wl6{ЯY0HUS%.d;g@kkLzMO˺MW^FGOoj * :{Kdgym Q .GD\,yqBj[]&_,tѢ|>3,ǁt m۔4-0{*Fr^}*n&ΌT q^'QJcȡ/qo6vuۉR#2hМXcb,%N~._tuTz:a54@P}0 gr,Kv}ҌT܆W;΁/~ݤ+if``ļh:ۜ]rDy8S` SZ{5e%M8 5a?͝$f;J!8yWVeXlyG.+)l z>:*ia3 p AoijOEZaä~ Ɏ؝^:{ 3G9QV&tbx: i:ꑶ\͘p;8Z!WШARY']cBPP3utwf|**ϐV2;6g?EP-7V`R"*ei{e`0Z= ~Ã陼iV~|5@g(lG yuibCv?5*<tP+ `8/i; nQu&OY4aE6ǮϹib AL5k.9NpR\N;jW޶ض`&IYn LRN9Ul#<˘)дV)d {›N uScZƩ>8-J챦EGc>YjF8wC}T-.GuY5CL څ!cͦވsm6X ~?$Fu4~±ɉopnx=.׊fд[v̻|޲=ϜgUL5m!e#o _Oe%c1&!9f{߬,+*W!rY+c5OHLV CK8*tLdgXpv5(xHc@mpio%K!Ty۔H Sǟ㪞\G~bTMdJ As5iaq&_j}O¾ WRéCrPAϡRsY~I0RLʛ| [yU,!vqp딪l( 8˿*~+e}ЃAhE@|qYcFQz 4G?j@IdCbLji  `8Rr6ޛx)ݙ*emAAhx2_@(#DžxMnK9雏ƔC}9ICy6fhuET_cDDAʝ94:R'*huvqW>;suwYaҀ\6|"%D3+$r8ÌwM֐$;3)OMm"h byWd@|$ 8n~5(XCz6z`h,x8$g`y!0c*"4ogr6^Dm1ۆ~mH $a(^_(|Eʵ:\ |CVDϏ&h 㭦a@|`IRRˏTvyT-S>φGvE-Xz]J-$͜M>9$δD ?fU9{$rjʲA]qHZ>lyyW%gkM16' U U~Xl\ƥDG35юnT_ 2ebWo 3yne5%.톀xEOo?:LCMFVfCV?X'pМ򺎶*DkcBT+nG[j7b1m&INumEbG|qA0/V^o.@W}/3~z#|ڵےFb@+=H? K=J/<ЋBĎq̖6 bM?ȏWYG>=l%°|-BS?2VĦ"NHg7{ vzQT|oEIXLh &0Ow=ꐇR'+{h㫃rþ`̻W.t1sypg?ƨ(CD dh؇6>WݸtIfJIao p8Ydf=*|=B~ua"-{bӥN:}̩o2gW5$)syڠƺtߍ\DKA? j޽֒d^}kPAW9ɬ^Br*Z66 +ʹI᳸3cG& 0ΞV $Iabk1^8=T%#e_`[Bt4Pl8JyњyPzJ1=i" vY uH굕#k{r1j%6xnB"ecG698;ƻV<yȞƓd&%,jG@.پjk&r+8I*uEmݢ{\C aE]܌Q3BeC Fl8vCz SnۆQ辏7=vp B)dS1"5 HyLtk:27Zٴ2I1X|TS&,.&EzJQ&v뻎DumLȉKEu=-}nە~{ )J`FR%2U8 ^qҳ#V>7l6:6F Kɗo6gHƧɴߊ=B)6c"`1JF~Oeq.N IgPVY)En}#=!CS 4]'dl#+wpTw>U\]+% r '-൒U) HHQ G맂~0NL +B ȮRLeGOys[^> T~G"HTY҇Li /.d'Pr (ǎG+ν8('kng SD[tCBA0GC~@YNaUtq6qwoS`Cog,_^riKZmK"[ xε(L W她-fjIzs5ecbBE8l:$2Nt jd~a6XJ -9j֥DHBKI:*I'jb_r"WG/6/+ޚEt+}Ɏן%6`Oij!J ?pJǼɮAf)-g5f&6> <H ')uyMyb_|?*F P5[cZ2b[3oE]hr؉Y o.W8FQo[WaƅQz7,fk"A*AdX[b+ZhLxdDݥN/#J? {BsøD Y +a)䞮}]o$|Snﲷ UM-;L}TgZ敐 $\C5'20cњbR> K,䨀'ULgoʧF#e-Ll6ؑ'T]{g')swQg9tֈM;Ju?~qrJRNf^ؘRh.G]m 6n:2Fۉh,!7>xAElMSxBTl}\J <#k?Db\vFY"u_ѣ_'J:ht7Lq20^5x;XT%7@Pa\%@ddu~M;Ugn~ C9)"b5\c8=Fv,_%$Qb,.Ъ%&1{*B`Zň[AOWxhC{L~(uegjAin0gz$QWN5K{Ry'1oy3B>D)j27-8¡z k9!:15\X#sl:Z|t8AI}j#ҢGF&TA󔋾ik^C<*AaF7q.6uȁ$gq3])Vȁ_ ,~ &0km6aRa>Ղv`3}`R[zb ProuNg% тM?H` Hpߓ]kQR/"Joo>_b&\b b":)UFt"uy<ۥi$0T6 MԴhϸ jK0L=vTU0d!բ R+)?L䠁$8Z%O̒iP}嶴šyi–#z%klw;D^EV!'7s̯C 1=7'&!5cEem$.9ha,vzQ GR`:`e, T'0!J4q 3Axߑ3TJ1IYjߢ̋db,\:);{d :r? ޺U)XH8fJه/<`Myo#'$uVˆL*] ?Ы3JjB|s8"6{4'ao9HdۣoĬ ˫d+*FR6yhuݖ$̗|"-n$Vqe!rTB 74׽2ν9wΥ0ދY;{`nPA)eKGH_]ƗٴֈMGŐw-ERvF}M 3-nIoz5lZrU\cUICUE͂#cЀ"Y,(4ˇ[⳷!PB$1Lhn 2q3,3 oIxT,daDLY\hC #77Q;`L7, Jh{iSdĀeQ0Ortu=_*8ĶH4]}` R=Ԫt֨MQZ!3 {!O?+5?܀Gl+0^{O{O:Mf?|p[b4wqMF3*Y4\[sh ÿCb[3$!o6rT›6s27VL~* 6.; EV,2<*!9|PFU(ENyhNx܊n*9\FiԎ8:mp  l̹~,3a^gap񃢑B|"  ݦR7oÑnPe7Im\4G#vX ~f5u}{o{5vı/Y!BeŚR= U :cRj#_Uۮ2 ֟{P'9,3 z_hV=|nds sIC3G?,7@1RվVLm&=Y)FrqT_a3 hG;ryK|֖[' DEY(Pfc(+g1Q:*ợ̔JӪI.;W?^@.R#BI׬Mզ?v?d[8CKQa&CnB*uf-xp4M15{0\ 7eq@-JZ:&/*D,}(s2uݛ?C?P֫%^e8޹'* 65Ϙ q-y {׀^gVş~rӦrvͷ_:(h'8cٷ&gv6Cb&ݽ=@I<J+MQ~yUA~E0vԬ1vF*vz!,`֔ר3 ]*wVɸTu,qlՖ-''s^+4MCZ ϑ{qkkUM1gchYTjT;Rұ!4e.>׃c4,9m)-bdW?vf B'=iʤ=7#ǃl+ )^hDE 9yz/0iKJ~9r- et(𰙐+?Mm%\WZ^̡af aƎCťMp<4e}n9?OBs8 2iC| N?hqYپu gX&o&#f`Tn&ia`hH4>&=VS|1=,&ftB-"Tf;rְzT|ժW[/֖r ~P(zp8"'i $!=~CiXјWiDJOo{kJ2 \Ά=~L8uvܜ fI%S{c}IA`"3De0MKi.(  Nǫޕd?-Ou2LH3`;U0mxyrup%owg @TLVbYCyNtl((kp"jRtЯSa0iq \H Yfz7 }fF-4WGmW<@36$h\6Sg[xdU3{CǕk`-7p3TGE0A`wȲ=m-t/GJ"ÐE4ʒ%siH0m(<*&p5LwU8pj5d Z$6.76?Tr2]Ի kyNAdjrZʩhjp&R'Rħ2I 1o:`ru6pGc 2F: l̻h~Hz%` r5ϱBd? 7Z0ϐT r2%Z4C[[ًΫRa~w)z=G}lE}pQ[Gj=T6V*JV]~LKwԳth z70`oxD{D*dn#6x"9ViħktJ  )mlmO6 ĈO!j2mר~v-guN åF;a(w17m1# }MYקo>@# Zf9gi7BَJmL __x+S/ r_%CF(RUЎ1zf6㉀>PtgZhq L1xUBӽ%Jd &=mC!뤣'3=/W JJW5#]x9b2n#ۄ@*br%ywu$gO%+˲dgi67 >xl"/ +ў_Z uXL}zu 0V7F-glq#EH0S _+[77m}^(,T%*9r+9ˬNlmƌ:nʟn,YRE`|KT -v[$Lڈ}N@h)ASU3af:by1  TjwLHh O;0 D<+pOͧ4udGzR4l{,mcP>^{DY"A>,hjU v }6\Vkd;nADM0ŀ:ЋL?Б4HVS_ hN$nTgN,J8GtJ։9 lUydB i*]+qYJ&oj:3֜˅Dk0?CޠZoWhd%jj 9:d ~W1{e)tѸ`,T E9n[^Xx|S;sbu{)Ue:)4# OO(!Jr$F+!]yvkxޣhx-jCAuzT NIM&,X36I k. x+ϵQ^*)SeO5jQmE%gmz_⑴v1£j ͎ґeY-cnBXd>Zl@D/[ <®O9P(cX`i)o@go8(Iq`FCT 8w(ݝ*w|%KR۟Z(}aaE/wѧ~b ^z'*A(әqI%OX҉9sF^dR?#Z&wxKvkߪ O(|EゑVpvAFP1ҿOA ^|F;+=kJAb9A:nmucXO43+;}Ջ8?T-Xb{=p|  su\ێ8I$ugQ>з !vu(gD.kNgVt5WsyN-v!kp̔j8#KV 3\\h*;g:'o# y=-]n O) h}?p"hA}Jd}oX!%(Mo@iTBz10lrw{}>qm^K0) r ] W4w6IO F!%t?8~WoF/? C*~ ?RSAhL[fެQ=\vO_jƒ gC: T*QH}] ;b9,s:cז-D:CuhmNO~oID^Q@hm HPX Xu0q6-ŸN'ldۋ.0ԶJ*)\1,-`^/٧닏 4)Y@L9-UL:_4{4Fo'@ |ε/ 20P;瘑:ª@_f[)8gexN'r;Dؑl^W(>0i%!ߛnT#} ]S=J#T&VJ\E!iF us "i&4FdXH'|n/.^*T!?C0-MV kiBo~$--~%3oς@*D^|^Us Aw4d^84=jƹ_׀D]s~Jfq﷼YT,5ƒ^_hSWyߊ='ضXp@1+Q)G?й\UGѴIg X2:%dޱ 'Gԫ>YV{\'PAVm`$؝?*%-[QUlwvpmׅpEA6ctj,v.2W)Dq[_*' K7mL^ q-Ev3fI~Kh/6"ڌ-.,bG;E+JzrŁr#nYo-RqM;u4@6t"H au뭔̳ï4ߪI@f#{Ko@|1rңն$bfPԚ_'XG0lEެqW6S ظ_U<'>74u;%> &2BC%7]/ٴ f(_+!m b|,P$1<;l=$XyUu&lt /E@3PlO&0"]r6)hu'%67 N'@S8A%9*S^z_ P6ȋcAa:9f^E庚.gju&gO%VO./+CksڢL:іWrr VqR=`%SD9'lT<߮ 0ogTm(D8* ˄|w_ݡ HmF:``^ն!Qr{^\A5L\tｳWKgn g" o쌟+tnş$t rbdL{"6G0hVu1jx[<8R!ifB/̄UEU| .  dG45d֔w\%e(%[ 4@hoc 1 GW#F@5FIG~264 IHt^jҞ f MEA˸+0Z->\Y+C0=4:@ KlZ\jj`s{Y=gR1T"$Z QTM8JWX|EcW<@~LM'tGFGrIW7|f$ W0zKN'S$qxI殮,Y[yng]z]Ji*7zv$MƘ+txTtEfG}LLhtfz>57it-h*S?u7E #˓24(0xx.Pn-c7ii{sc{CixKQ#>t(NDyOfI#*}NkA>ᓴĭxzT h a!hYT.\|--;EЇ,Rѱ5j_ BTt`CC&hM]Iuyت%mU)5|'}EhzS# ;ܾ2}ˤF (E򃻥Qd+t;Ea/b]q'$+)P2$sw7I4礕"׌rnLetź>evd&wv8Uql>+:wƑG-_r#\RϚ!aَ'$+t~8WוMz-\p!s;{wR'12yįzفc :JU#їLOW3%F5b=n"|p0)/y񫰕-Pa}7iփFf]j C2vե쨗bgAxzW3s颤 vJ?793e#X-U/-N3NfVS։J^d}(h6CB URGr0H=#wT΍7đ2>ŧ&J.Dg.sBs km])Үgd0Ķ)u$f(ozM#[PevŸ:iM;T_*»yVmz`kzf+~B$#Xl0W6?PR]qW0s*"!$qƒNғԏ:'r) BOrG& &Z["DNj:=o>7j4Ak.T+L׾*t)}a+39Shm*\B$?7}Yή~,MNc:Gm!qd+h;o}3gVK.ĚHBh2 R%G8 6qOZxj!;T."q-#QY'?TI+Vt_ҽ` Fe66P 6[sa҈Xfª#dm22T ᮑuTh,ԈT "CPZh$Yta7KfM+G0v&<8$}٣G^fnl$8A<ʣ܆)16s1qk%#dD}ۅ&eNLW-}%@.3_weu![6Z`(uy"m2xlYTY*~|9E(BXPuTpݒWfU X9W,ypH\&=C x\O׾}\P:(y*S1 C# 3e N%);qi"s~b_Eާu%{v;SS"Gޭdd 0fںo9oC/z:%b56eU, *ދJ]~D_:Кէb5}.i#D$+f xxh`_@?k?Z;Iҗo_U& o: \~fc6<EdShl .Sq7.i)-T,o[b˾RX[tFX} n_ǜ'ΐBZ,{4[d֞|vC̃0/8(v@(#c1'qv.CggFn9C| :[Qr>d" -Jf8aZl[” p͉0Wkcڄ"CA߹yZ9|]F}a$ׁ63N2s.6"4SHw:m?wq_ZuR7y9W).\+o_r<t4 ß%Y]}f\z:t5TWhz3Dl N=9 ljyJn]} 91vՏwzАx\nVLW"Y?*۶ggy-sy\9T`Xc#JA\q$>Bo`-R@Fڜÿ!P'֭B?k2ܭK'Vofx J)7᜸R;P Cghu2W\5´ j ]ᢈn-(`[@ZMR{ԍ!Q3u#vB^v,t:[>凉t`wk5soE%*@ȼ c]^قVӥD ۖhu10Rկ]S͛]5↻ݗց; 82uc:^P)~tL. ]B({j~glAILy*hf3 r/ÁXnjpo.{m?ñ\dSXzR{Lrn;2s_ڥCn5.@lhN~ $t艄9(KD&r]bs E\Z1U[;DKh)OΔKo՜P-!kd L.DK[_g:6H4fd! UWX-w"r7Q}I9>K/(!~1LU Rc2´fePEv꒏3C8D:)|^+;_jl),n7YA0D(!ܒgoTRS]"KN]TEd,q&˂(HNjR~څk'+\kK>{#ծ_Ea&h~x+<tLdyy2MG@LՕ SҪYӺ/C$p AULn~D#Q.INncA0TW|hӘSބɕ9DM&e֓DLCvwZ-"^GP,CXRW][v6wG䠪};CZň} 愓OOIWl3?PI[mdׂ[F]塜l9&2SQ|xr++|ڙC|~Ʀ/¦lGjDWfYf%t&Յ9/}9Ix@'V^#>{t>FMde?uOvZ(8,UsٌNST Owu _I_u§!?7 oIe̥/F^i!7@:W 29a(oW|i=t\m?Y-*p^Jkb4+Ư9<;,~! *ò6,gk `.DU;o(b =-ʯ/ 9f1RDŽ傣BݼjXSS'p؀CїƏ2{ TT[5q-Bd*HHٺ:Y2}/R~| B焋L|`-v^9Ea5 q|X#c5HPcN_y ~Y4Xaç*3fZ' N?Ɉ+WIF-#6UB*Ovg`Jv͛)9()k JɶPH+' j"bnmY .dZt?Ƹt"=]m$]>,'N6&|)]H(_h4U"m0-ݕ^7گ,nr[!xrZ=arrdDb2t72N#)0ASraMzj (Q_=bpTm[}k_y L}2Xz.gXЇ3ngcZz< DDF2=k1ËCHSq@<@՘{׭vBoq6j)%ύZqW_+c/F6屹C؟sym[\9*$vO=+WJ'(~PIWzڅK.:{e&uwD{ȧR $4ɁXS0u17/$e $YDu (9$5RԔ6G%Y1_Nx_bgxއQciAS(? 2͞ܖ5㟥[j#[n0+E(MZGKgc } +>L=FV[BA9:7y^SJuI/"R|u1r0Yq >DY%+yIv^"g]꼔ByW"hT&tiRfpإ3u-&h2X3>- 2&8ޱ_[qp몿jĩxBbIeE7yrfwT1cHurk`L!. c$X<l Af:!:%a3Or)g߉^eL ^^X*LC/X\כ fzJW~tQrs: )8B>F|3pht Ӯ-V9([_e d o |ec~nSg>rTB6*NN5Jk Pk ÷Ny q(pkm=^g~|4N~[WC%`vJe M1Z=Q*) o}|g硞),s)55:1 1NST17S mmXي{M^:BUrɂQٹ'Rħ1U{F*A}Y(L{u3vE9R4Fjш9*FMi3e )OƧP!]+4kۈi=VhS$^r5ɩsEa%EVfEkr/kϜh(DaOm_Mۗv_L5Qb 8z%n"H oWQE B*~cp|p]ׄEl-Ek]ؽQqTU>7؆~Sx92*;RڽًdSTiz d%!Yth{߬ !ޝ,<(.`*~f Xj4 | LȠXdXEAMv=ĻKuÍX$ʗ"zMLeb0%5P\|bk}{Xj0VI?%F^I…Us;_s 9Cs0ijқ1Ie[M=< <>:y9ܴ}0*qr}$ߤ#6a.Fk"M/᭾_:`] ld) '"/J*@?ەaIq7m թ -sU4T $BbbykBPX4nBn+-co(ex9%ɉ\ ;cc<L%8NAxCS)^w"MEvee a^rP:<J"MS^+ΰ"!mAtk{C(ZI1TL D@}VkRAm+%iL6i<<Gs5-Y=QS9S6Q{bLp,PWybťY Κ,u5hww;#Y;ѥzҩ:o63*:4sJӼ9T ~%ąp#޺0JncBɞ尀 K 6^C ֺ 76Z  H%d'{s:B\@hZPdkM]/Ѣ63 D;"F|iR=Ͱ!#%2۟ddKS yܪagP.'5E 䝯vB7A%5;Kó'S8ނ-ˊ5s9 C? ϰdF|M9ȱV$EH+46^{c2k'r0uöm"jƓ\rGxh2Dvr"8R:m 6Azc9);99G#e{ZDN$7 ʮy,?cS AZbd+-v5T:dj(2'6EvI nr|#O/;ٹB ojw|GRs.0۞,2mKf,g8('H>ƏB'ȁS@==#dZ=u.d#qՒx.0$Aq6fooOAdz~XL͐ז>&ҍOF4)_AZU"ƌFZMmu]X>!0}׋9N[MΠ.;=]Cr1&p):a%rkEOZLKxAiZq7e n$Dw c7N7n!S$y?:mDEGۏuBEx2{>bj jrKF{ich,6/So&npȶN=NW 0 Aɵ)ᅓ\_$tiC&M}ӪW@Q<[Alþg!4~ ȋhDhfW>c0MB?^:R|ŤTmI9j$$VrHjv@rhC >cN\]A3R,20%\t=ژ~m hN@7GӒq|"a:{jgX$\6vJʕ'BF1ayu0 sm *]b^p-hA낉{*$\dTk`嫝XmpТwgf4̖e~4p{(٠~jitFAO#{5A5$KO ibmn!{0ziE+! f:9"n k"As-[ 3R$?QP56J "kWXn/><{9׮p`AJ;09|o9yKi|%M 扗o3JKvgjh]&iͅsu)딚PrI+\!EH9b၇o0%0{GE΢, 7qq3 klY*T$rʱ ^Ӿg䣣 }H΅qͭjFRf#D_kz*sd5l jC6oR-:qʔ2doI%gƬL@2qp*bHWJy~9  eE7X@.k/+J4ښK U>AѾdh%Bq`7GJ[f ;^ _|`e =!Y9MFz(˭Sug}I "bnyi/})37Uz3|&?tc[NV鱻)8LXi{}vcb678'2T'a);*(g9 Tg8ޅ:c!19zRpIIeI,r7l;,PRħqJA)a|(BDfgsvП{ptӓaK8q EL7Ul|i㧐Ta96QhoҢ r]ѶoɴV15Rdw&Ζ,_1ZGJ۩.7xO[};. bV%(MJX}xW;uqtSāO) a<ю*J]LVZ-%"O~x);w*o0g,<=BrSX{IM9rf$gZ-+% jƲ5F ש\ZαT}sx-o(H{&ÍfxS)櫽{(;'\wk|ͦ:Co} -tA3"XT^tKPh')C fk~SP&DeprO$nzUuu7UK#!cxEpj +C2 GS8 \aEG̕%J5n߾yhiSvl8|2把?o¯:&cbZpXCbZ*}w׉:d21$~]Pyvw} >:ξ$)}Uq4V^Ĩ}g7cRjǚIaʬ /e¥JoE6.'Q]<^ ^-,Y[!MD~}y+5y631=fDAh )BtRga6α;t0Gvr.q5]F a݃u%Y64vTد:]z6#oMRv|1E;7g_P[  ԃK%OٴIËz;D1ڇ^P^,:_SB_Ovf_񋷁Wkȳ8+iCֿ\%̨6m/ٍ6q;myAAVֿѧ0uLӝ%W#FxdP=ۚ=z.'iU~/3ȃ3)-Z ̓:48y lR測7Gs[⑄!W]c DTj3ڑ|$6CEMiOE؁Q4J>ee%' ]kSbBw7t:?!jPk.6 HtTMgS ufEI9{\QbFR c<ѧ:(^.:S" Iv)M6'D!7xYOjR&%Z8S qC#y3nVThlHɬtqmhHW  읨X(: °Qbbpi>Y[%OÍ}áO.x"yo̜#ETpJኸ]ډQᯡj3tީ+Ho`jy̷koS3ǞY-ꐨvBڼjf#k]Sb [E0a}ͨm^M\:uEգe }NA@?X+D%fK{UZ&1F~6^i_"k-!ظyXS =ЁuT&NW za:gSsQ/\zm_S0c?sJԃ yr&Kl&-LF9h_*sφ=bŀ?؜y<{o(n!wNT*n k>~@F&Qg0S|[5^r;AV5֪ ~;.b4W9ʬr9£hF ȃ$v+}!&ۏ}쫨ui$f;=!J5l 9P<=x08U'BɳI,g#DIJzJRQN^q#K U36Fk و% QbQ-ϻɰp#^!֩:[v-NrEA}z% ֫QuLJS`8c(٣ůrqLg?p1`u bGr[9GKc,alc)qgqvp~qmDu%l"mϱL_^Jz ܟGd5_^I^13ZfN/gdnLRzsU#x`^98/#gB։ \|UjcPu h,Iͽ_FX]^J%5%] eM@(=۰n M2DZXCex^ghv6$d䍖(Wa&7D*0uưCfg;e.`dazw#K_c] ;pb' ta8cDqc\x3m0h5c#|[fkJ9QTvIfeO TFwVL?D+ qT;kH\YCgdY[h'!gɋ*zJKF7Jwc4ђkm(G|hNQӀW}z]qt<@ 60w zWmZ.kn;CYfa^bx.MH@UhP<2ˈֶBc fXbz WW08DK>~ Xx.+ϰE˦﬐11潞amW?[?8+^:xWx_H2:L.V@=z^V&u}e-נ,-,+e-%aΙF7/o.A;|v']UaKLӇ5-\~|>!|r:^zI&kV/Yqգ-< h@Q@%Z|9% "\=!9<_h 0\}az4`TfMAC7>=!XW)x̏6QMԓU$m(eVi}3Fŋ͏N붌\t!QZc|‚8wO㷃 w+W78/.<%*)QJe$E| bw2>M{o!S@# ^C! 7whLM‚rd;]dѷ/؂VBH[ m U`|LmXjҨg +,mE_e<}P#mУceU>i]>{HUROP>| "SFvJay,擖 c&Řq?:3RO&$L Էl0T.~5[%<5s\ͣrȻ-/0BCd"GމJX>-g/Xk3f*3 ޭ`FBΖuڳbWC=Gu/D%* Wy@"g9H-:/o.ttb=yssbb}C di>QhiW֒I5BHhV ZaBSK#a[Wr9X==-2Zu$$4&1cɩѻ341n $+8b5-x1'O 3;l-.l{qd&8}o3_&"ZUrXRAtY5Y՛e.hݒkYSfu *3a?t|qCz(;؟{U4Xfgrk*ULH>5j(S?DDcela) G1h: .yת[DG0^cOr0:d/3#uC-+e}1G{.+А)sG~슻՞9Z#F^ Q̧u[gmJzM%AgNlHK[O*~n`?.`[|;(@߀e}&3#jI r~6g9fGNju(qZu?1;yT؝&w[ E^ǺZVI=l[\{2{#9E@A*t>z7ӛ}[nKףg E,g{*XTڤ"c9(_*,yog[W @&s'Ph(F;&тs=G=.Zz[eSs_9'5>SȓuQE I)q#FNGVx7:FbqGM=&?ؑH<5ІFZuPj`Q@WLoqh}b<۵9z'FcVfQ#jkYsgIr &9h qX4f̜8NSuST@^}2`rC 3ڣW(#;9>Va&SÒ |JX-lGB9tA{tB9'- h^i\={-;ЙʠR r6e;C 3Dȯkl#:ٌe'i5θ/ZN7O z Ԝy. ^ =xL0p -z͋}ݛl |}Krɷ'G}؝iݐ] 86a"Lrco,5Y,lC+g>5WS|k(36h=Ȁ|rM4ufZ tUTG?X3\BIJcz]DS.@Uނ/|N u Durj%bH4 n 4Β;phDP&qil1s9|{2ܩa̜:Ga$΅fi;9M3Qq'>734p_|U2,x0FEW\xKpiD7pHPOMm^ 1$p{O*HЪhSgȅU]anQVDDX#X4%O>lTCRWaoA~&cm~)ezmM;!FJ=!8 +1%[%~z7AVdy?t|sE<_v|O(AV/f?  g\ׄ6Q?CB@Y0d((Ǿvg6 I~H!T+50AR{+NA%Κ*Zq/H{(HrM˹kF'|ZtͭU oOhFBnYȟ՛Y#V4p¾+!,W(Oѥq+"Բp`/)῱Wi6j;; sIq:߸#MzK:gDXR:iF?+I>X30 GjPSlnly%BnqS=mu&۪3 'l#nQihN 2RqaexoMo-lJqZHu[@4쥎 %)E/8I{ܯ8C̡m~ؕa#r+ː nz;\#~l,4^r+J;;7-81/{AP_5EnAsDFv?_v  7C+SqHVT.5]Kx ʅM9Rjsm fL SZ),1aԖ88h,GXaD ytG{s'+֓WՖiy_JarR}%%YNM}29 m㟆u57v!ˢ{n6r<^њIhB2=1YY*/O5p4yɬB qy*9#?6 );ndX ͏ _Hj*¡!gA:} &HO"nI7|#R^|&K^C94Tl|HWRk)y ^*/~XyüYơ&mf0b|hԐq#ڀZXn"t de=̙rˁu!DP_"1-. Dӆ"5,slc!ieMz̃^(+.U^Jʰ`XT4F"лrN-iZOvD]I2b/I ءV4>=LjOфPd3Tz ״x,S^I,%*V `>€ymM;}ݧX;,I0VTJB(n=Ǥ˓D>U8^bc5fl&^"2D_X";ɽ?F3yG7*0KayaIQcudpYZhG@ LF [ ̯!gji{ds Sk9o]YK#7o%{(^mRBϨ#RSh@|7Vxo',:j}] 8B+*2{mԹ%١;}*(op K_$lɾ%ʯP4 8?{`=1уrsEn7D&(30$:͙Smq![ᕄ@̾'Y͎dY𵧈\ż C̍=;gH%J%yϸ!Ql&ݏePu}N!f LǪY )Qt\N&nR $ \߸^>!]~u좻$_؞B$(Qd=оR(TNy5?MaKmCsiEO#kg([T~&RhQ9]3bxVYI$g翣̽N\+_C@jJ|Q3>-Ϊ{)dwYXTϋ<k^i0WZm+uڝ x횢OdR-:_~E7]k0oLy>Ñ>=ˤ9-:p@9蚉*uw:/K]m5m[.936նZI; = UYށԷsaձX򨛁eA6kՀPecqخF 2E_7.0 MuTzVU4j3q8r\UCZ eI g(yzsI}K$29O/wn+ګoJӴʏ>1\HE[c5LKٔ!C}v #o%Kc Ocs|/YOLMG]q|&*5NJ]vqJʺ=TBk~vejϩQ;Xc~F)$t°'znt>.,:aLJDq|I΃NYO[0rM&eydn}6T2oz=Kh=|zk$lٝdo\46N<}8 j^o2#PZM٢Z^x(s| Ѽ l10֒ Q4W>-Rn ⚶ۃ:̛=NPXira()x#A]닽`C)IB1<0U=coqn=8k{q>8dy1+@f,!3ݗݬu6`!Ã({b#΋?FkܒQd\H>BPG&9ȧ7Vfpו/1 j_ΐڦAkz֪SoTuD(a-,y{u УM)&<q 5Gxԓ3t8~{=O"WKc>X9f"{psm5RXpTdq4DQx'PXqN>w"~8Gz]*$Rj{S&ɡ̐csLu*B`o'_6qz٤=xNחXZꊦ^--vBYIT29v2`q^\bwfI,999^ӓx'wGi7 ΋ccs };ߑ 2اB [yBJzKg Pz^U{LG&fFoAV9+c3$#C&rb(3a8rN cFd> IBdc$jcpDptG:i@퍧sO 3bK8Q^Ҫ]!,Yo/ZI}̈nkCul뺾h,?YBvN`]X,~\xC\:mf43 P"i~t`Vh~Nz-*NJ2pPqkR2Z-ݡ̅#Ra,)0;Bݽ&:%5]yo Z9g'\ֈ됲2 ðpK:\/Rg&wTI 6(UZ.O,>:ȮU3xWti,ydzRҔR(0:wQ/cu`FT;H"% nOM j9l\yglP\eT~ĥv3 3'NfhdAzo0rWҰWu>_p/ʦS(C k m54Nh਽$} uiOl`-h }r&u }D/wJyr7#_~ƒ?@Z^Yv Lߒeˊ^ F ϙ.+Խ?e`+lbD\|ҿ`'c?g̀aUO#@pә~ H21r(UTeM}Y#͵vN>!V٘c3z)\sS릨ݰwŶoru1x@-hN\݆ rxx`ODP1T/.VkN2ߌLe='Yl̄fi|}Q>[ɰM )?6h UEe07nvR>ԃӛ?2Mؓ嗑ȅ0֘v"r q9{r m4$Db+C C4?D0 d°r-Ks(Z]\'⶿0TQlD- i]d(`e y{I 7]4o/ x&yvIl4bt ~U #oT.[i騲<`&#?2ͬ6 ro -B]o*p+wq c24 ^`ֿ7TiC$'=AS4#}Vdev\&EU;٨6 Yf~E޹dl8E٘`ܤ>lw@Fw6ZeCe;'y[G6uKv6>@`7n *H$8C$Rl߹< 64aOz'*e/sc{Ysxd7cZuN6?ck[w&>Iw68'&HمDF5#Ƅ xϔ'1fZ` ǜtTBe[2&uc Zc/;Ej#Z2uƜ&~-f2h=`aPk(E+s+!VtA>OI<^ͳS<ލ-{-gm`a<""Hm z/nJ^A:RLS!(锁7N;OhԺ,>[NxE]ѿD8=+kc'" 0=.`{6/4}aiK':N Z,hͣ|~{eF |QȤ( di^NS%嵲1{"HCTM$<0t#5/WVP¬r*h>֓-~s~,ŚAxbZ.55E%򦥑igºiiz@ |}mJ,,+LN|)Y q/$8(pqx;-#M4dB+݆XFEe`UӪ%eSS?lL(w>e'1y%R(lh:kgm7jRoHLx {!`$1VV:_Eb˙(DQT¯sd\`w!MC PT\ݧڝLQ#/ ыB蒂GbR4%w]3i?[r=a%YSVI:UJϖ$Sue@Z/ Btu(f*3nS5V0h )Q|{C Ic<[4BK=Y)I%ktbwPP)KhF5I*lU"9iM_m+duKY:c(~m"&݄В TtV)gDY<ׇf|+ p`vN9_ $qCP9YxҔ2&y!>0q3(~-Nu럇O ,N)h &WW_MqKL^Rv[Ъ1n:q'Ta` soo>Fd<:60o`0zJa>uݒc/fPA*@9cndl'19H6OOƧ$`S:$&ʌSs쁴+t) Xĉ5 zA;?nߊ~'򝋅 n!!2prjTլ#o bN'Z7N^l2_m\LHk]4a %ТPnGPxg# #ZY0k)! pͻe[C W?@yәdH"_6&g=;|e Q1,JU(3aASzZ.8=>dFSӡPhxuMQ*i:@KRua0_Xɋ<†Wa~V01D*[yrۧry}7šԲη[X}BK*_.bN%'Ygx8(sNY!tqPe,eEȺ#{8nWCtƺ^#;!}uem2X-zkdݜM$[X Fb9sk{-$Cd%"dI7768*m" `#|((oXYעns CݑZlO!kq(!+Del"kh8z$$\'\7%!:-b5#vߗ1 ]l8OIBG^%?wGD${u @9'5KB"N 9ic(E=Xq[~=>5HotuƑLBp0Y<\ !#Ń efCcoF>]q:Dc ZQqĵH8Xa}q;{x>BIєTS֥﨤`Ml-=TrJՃ5gOgLֹ,7RvO,fyr(hH5؄ Jp9 9HUɗ'] e@|T>ș-Oo۱4oGO8EGUb+eWvMVR9;dF.Ll6gNSߵRʸq^i?5CHm9^Boф6۪`X"d$tUP > =Kÿ)9SfXq5J'8McnA hi 2CzNUy+#pF} RWs>k";HwAu9Iځ 2˒Jh2#*"buJj82n.\(nu&2H)[_߀Ϸˆ3[GCO!bZbt*ms^,0cF:_APzG kyƖ٪̭I:BXxv0zô1cp \tnI;͉<06N1nHGq-֓r8s|v4ɢ {MJ\tXä*`ӝ^oHy;) \y:{%;"-~~4DK1$H1`uFy0w{|K!,ΐOXY?n !#e1;Sv`eU޹VAћ]>*Fif 20r&H,1T甞mE윮f̥pCvsR^efB5{y^kQ:{ oYE'" W'r+qwo1aZk L,G~onR:LJv15}yK.Vjv ~=YOl+—z0,r45gY<&2. mL׈lTnk\OmH2g`2~@ā\ywR%$-wrG5Q k Vgbo!Qs:`|?ety8:U9o!$ \ԖRrL~q5$io #UGY3:a<ʙ[&[^(ܶ)c7w꿳uߦ-oZ2lxg,Ñ^́T8܋D $7 08GS.!B }@TŨӢm;G޵|\9.Sws(Q' ާ ÃX$ΠuCesePbC(RS5sp\q8Iޤ2Od1~-K+9;;ؑu0C^j]2$Y[,J/4"L(E5d}ZPuu>c񥟗NeJPmSkWfU^*хE ֕ޖm2{l o sHu `")ڱ8mCmtgt|9#H?oߵdacZtjFrݹu!>@KI6ZZP.d Iq:}TyYIᭁDDJa6*&I wmC<@RAf@MrZ#rh&m9oƓFڃOa6#*:ĨDvSF؆coౢϨgl7RvZ͏:fCWh,_g.XEAc18,An'lu`nDɬY(bTHuHല͉ωT_.qTǁ"BGy60 bTfT_)/Nc|d0zZN-9}0aBQ,RHg}B}9Օ&;.fct$R'GspD> '>Ʌ*b͓7>ų/ME*KwnrX#8<@6ųҳ-&ՈD䍴[s$sӒphƝ;["u^.L:G)l &؄DH&d=򎿴%5՞)A|+ ވDlAL5'1]f D+YְӅp\@w ,L %UH",DxH8-A*v͋n2Q/z|X,5 >+y G? M%K7i=5Ysqҭ>2K1\Z؟ `aCbf#*ucN֤&+fe҅s ץ0O,pgĦ%pHY0.kE#M˚mm3HŲ+\Xs{9L5C_Yɻ/ M%<*yzޞQa&#Bo;@bD+#,އqб鸂 S/Ǫ!RStC]Q(=M=T`r L7Vq^dEC#HIMnTJ_<E)ѝbB*/ROJ:yD􋛡0UCeݍv뭗aI^Ka2 7~s{@aђbمAU9x)79WmT! eWNOK+*n`YUTJf>Vv0}u [&>îN*5qk7"-)XrZŪVEaX|Õ!EM97?qC# cuM>pG 'u iv'Nc"٬'ⓙy\EV+cFij6A> )EUr?s Б5 `Z)C#@մ:'o0V:)ݵ( v't]Cv-C&pN l^;#6澅}Tc^+f+4d?sw_,\T8чyk9*yuwd@?x|/g‚x(:<]߬t0а3JDs&T(8VCŭaZr%$unfo%;{]HC5xӯ[ٯݲ왭tZDo&z/ld kkD?rL=9&P__:;ѲPes|2,@"$٦_>#je6ڬa[HV ,[97R*W0jlB̛pܧ ƾ1+vc2K1?8B+=CA ?sN _իxQcۊc.; tdT"1[$_.&dJv\ s#kĸ ("pD cieٴV2mb7^B\ R*2 U~̳J25.,wX S?3섂 0=[\ (Ac4lR+.H}&/vU ^ޒ*]ZAFO*Bs.M-u4{bD;"94+ⶢܭ~] q3Agkf5.zdnQ}Hz d8σ%eSJ' :Afd-)wWsK(=甁n S7e bF*˾/^w3 ?s-LNS% i!8;'g/ .W _*tٌ, nliq2:߄H'B kzcoJp_F@կ^`>0aʜ[ؐ&T6~5!h}5:i)1>l+Fx4+F̈́GtE2x9}Dɮ0–}#W 4K bDᲨS~B԰yj}Vy`r߹6#|} S2lላ`#nuCu$u*)/@Go=G[3CZ^OJP @V|G 3ϵDr+Y~jWd^#$ -Ъ;&¿vh-beeJZVkMYl~Cq/対v$ˬ=zNQ{$ )tGA|+X}ZW6|tWFSY9ws&EEUXH17˾ w(3DGZ-}ThX٪?}Xj{a=t\;)FQ%"$cԏ0D8'TyM~L??lD j z׺)A|PfŊ#!p,T׉96pZk7].ث˂ Ljk,z\pNUn>$Cb9_bLWTimqkcCў?, sRm#׺Fܡ׶=WwNgv"9Qc=l/]Ȏ23})=o[~PÞE>MS+k޷ǦKQꜝ%O4 7 Qݖ=PԘK/Cuwv+蜣t%?*Xo8:mљ!)c`N=Ab%weWB'91Do_q/mD޷ޙas! _j7V!lt2˓0Hܾqi{#M Ü<~LK ^%]j-Noȱ^a&@f_\~[NP*O2+ Oc+`P]3r)OE@^7THAϻ2z7.ǖin;D! 7EWZƗ_TskRo +& ./a6QJg}τZL^Q 2Y{UoD"eamN`M6>uᬑi.GwW"[-0T>$EFQsO:~ZZ%3QVR>٩C7dwA )>}&yHֽdct 1nWxgLkSa57 hO-FUF:JCТ(>gl{v (og A7_Gj8g%ײUlϊ{D\g{i%ƯAB/ "j"^ՙM ΓoKEL)KټOmCtxog  ߏުqk&4WRXOgmi"N|$:g.tŲ S8n%%9=Q.\\=ש3a#bWتQ""Y-6$^ ;{Vѭ ﹫S.ـ_<#Vz놯!ׂG`蠣&$ ^ʩ1ēEyfOZ 3QnY= maw*Њx%1bń#fw@G(mlھtQNf=p}^gmz巚z:[#ʚ8Gid{&E E=*|u#WՑY" ;"0Г; ?e̍&M^JC|uZa-?m=ԧC3\ZBz _nn/UhOlgz=V񓐃ȋz+O|5/HC2pl}0V CA/7H۳<ԯwdH 6!{#-*/mX -+R*5j!MEQ'rY.5Qh~`j*~=^u1j B* &lj8{"?>w{Y&7qdb ©|öNW?Er 8Hf3V.B>EXZ;T6IiJ 9_U Д&)|{vߠuaS`ʷk>L){"+}aaUgx_6(ET@*k"K(ZJV! dm@t C@m1G?Q;J7."D#F_`p[wf>:Joo1膣h5"lT^vT/?|/S*sA1V}x'8ޢ+ą2 S.l[-۳߮Ql֏m{n Rxѐۜ25f\9VW+~,!>\2_CS=X27?c6NJ YR5nHtw-1(76V [ w:y:a1>J~30a\IoH &[Е,Bǚ%&na Gq؍@R8a7)F,!qinv|1Q 8c so,v Aj#*omt Re5W ~PVRG֠ZlgrvP9xJDw5y75vnAaA>$nԺdi$3ٝf&Iȃdi&|2&BFy07wbPuf= /q?dpئN: 7h;rf4f>$йX!(o_ɬ4B^,z̸ăEu@5/\;}C 8>4 FĊ(cQ-Rb=xeyWReOt\eb .hpYEa3agB'_0nt 8E=; YHqi:BV?Jm]ΨV>xL*eP [S;& c!Ai2|2ٯS.e߮7.o9;,~.$I8̵e,0úpܺ(aFCoz̅J+1qZh"bY1Y?M$n#ÇITVLV"P$^R4LX]X*^酩7;`P)+Rnj8 3" )3Zx8>'ڄTegi eo1#:.ZO]P|2 rC[]MrL]/sȄT)Jf90qDGZnc˟O={~7sрISv!#XU f /Zݱ vvlC&J1%ɫ Zҫ9ͮLf|vs!&wMU7ybWyMrZ^՘j! {Bmc* 2J ZQ.8z=V&A#b:⹇g@)&wP 2A}=-H lkz %{p˷Rfe|8Zz&H\Q(? !(I{:H+Ľz톃|΁/c|" M E𝚒=e4n8ֈ C0LqO Y!EoXws V Iz Nmk*hs` \=WHQjo=YG\x Gt S8SSD3_"Ƚ!/bcmyCA|j*!zu"AAU9T]4bzԂu,j2{qBbvNUS܇/W"/Zs˳*?NU(^.wZ#[n 0@G[F(m,RfR 3қUXGmsC!kw"\-T}:j/k=%'{Ty$v~0|MT;@|őgbLn!Z̃cNCZ( {^fżc *quj.|M.|*|ܑKIOVVF-- ; `dX1m@)?>>03ЙuGhs Y ^A5ɿ9%ZMZx@3.}׋ArYUK$7_QE lQ3Zx^ S:N+\Bݑ|v,OAA\5A.1CBA47P=;w}h]4gsR%>ndGԄ5giREmcaY 6ML4 9=}XWGsy^QX\Kc` Ac~o rGjL_M0Xf:sbskzDHhfԲUiP Ӝ*8v!vڡ >FvI-PP"_5eɋ)C-"nWq90v'ij#sBeNS5 @@3&C%0 Ǖj9&Bz*d>z]-̲Y 4\v혏$BϘ/VUqMTyErYN;s$ Q Z E7ؤ-)C6ԦW.~~(q^O 3*oCZIyt;2DTȧ%rJ>s &t$?ђ3Z-Y. '8h,38p@D3u4#4Ïkwܱ\Y` X5 Up&'\`e2Kihs3~f"En {F̕uV]m;}1sȆItz8c0]eV:KbݐմHߎA%.sUFu n4H#کg- TnӨKw4j- [wmefW|ojAv\^V<̴_m51zz;nz*G!Cs j[tEvJ!/ /*D"f$h<^ujvlٕîK$q UqS yhJ4MEX3`(ֲrMS;['DBi3T)*_{|4P ZR~+|t88SE^H(/}sHܵd.uMjxi#$[By͢`>PU|#ҫ6Z_H?H:CQCE覆}̴xP}Ȱ0B-<[dhBͬ x'$D8@%7/r>Ӑx(68Q=lw-#puֱ,`@B-ydǫWX%Y_OkMKU:Ȃ91JzLݯOx !^.bGvmo9yHjjv*䎂 FMCj5'ูey/,y_:%#7is rp.W Km:Wi꓏0ޏMm\t6C TnOjiEYKɌDS-XTQtȿ~.{`>lN:MAh t'0YQ1ӇvxF0:ZmsJ= ` G fI_$aOoψY۸YȔߘ*񋔐R-lYJ%MpXtφ[ !DA)С"1>jп."_ ɈQcm7~+}xwUQo q)nqu??dMPК=QXs8M(?Vh.vNdgՌpdPT'ehLKR4E`Nqx(/_W ca<3`̽c푊mNaObun7sW.ć"c~Q3=)L@ &5T8KOOdžqw@ޜ'ӓfU+EMD?k>bYUp5re8i{|'k4[TMsʧ4ʜ5ʂ."1v 7x[g'j'ôQi~pj}@,` E&#?o-Zkn>L  ώ5 S c(p,gy{ fY/P>OXƱc 9 icA5F˧ֈ>."??5|Ē^Mn0&S.cg: [,]K=O]U?2Nl^$>x waYh,\JZ~j{n:\ĎCNsC`?_oCM_dA9̃;QG$XP$PJ!q? Ȃ (4hmTW|'OuOc)܍J''1 Ԥ O /I l7gس{ N|%`U{kWG<n|- %#NgqUrP/'>&5޻~liJ@ NU{-PYqu#rU``^# ;,q(Ĝg")`o\hj-k>RJVPıpĒ9YB `Twl2 V׭=KnDzs@lMOjAnÈ|^#'%5/埇:}.cʋX~ǂg$NLN~xO󵠃kٗԅ|4:ɞ2w$kIP[oguķR(գ0&e5 #E&R"Z|j/7G2 IqR;,Xb=IwY_9.zA)C+%Fb;y?㖄`hI`䛪&X^f;+ëN`6-s<]Egrxt|%tyb()K_ȲgdCraӞ / C2`B^_0yoY?wEk*H8%)پ=!J9ϥoڻ)}menOlxx;0(pz@@O[v:3?9=#Sm@f4=ob-]1_Jc?,e-<*Cm$=Ĕ z|\ӵ'Y7^eۜN@FwW`p.:Q_>E\g0p^yOSFk;+ l#/zY?qrUS96vIIvEFfs(՚mA*ߋQlb}(ֱHAf_ !?}ES<}bPI&)Vi,%G-n+UJMCGluN2,E{WT^ZR/ |zv=hg>ϝHBKΰ< nHd6rH {,wdvg2[D֛/^<,R֊ -U;[qVr8>V;CŋF'sRz/kɊ_/OJcF/"k >& 5}RlF&,w 1]r)sxxE34K}]Na^AikQZzm<"QG#7  -:uu舒GqE 1uau M3ihL4H)W(ſi"`RBla3xOfɤ tЋ)u+OׁoxdžTNfsy@W]= ]xp3C2vv擀,bDLa8 -A 7`4DKqUb'][Otv!M&տgKL6Ae1)#ae{5r,~L% xAV_c/Ms3+7}$b ]%&h uפ]d'@uTj޹I&\DwO܈N|ͪmd#Q\Ή3}$ޗm3Xy_gh)6|%lMh*t){*f$馂˞Qپa.qG}8eau(p8%5lA͒+&3[̾?h|3]^ +d7KTޓ爞"u&ab) D罢T18C/Qq°*^P#,?N<t"pH>>eca_ls. 2/{'G) siY}⓹0%`{wt\R8(pyJD#Hxb6> v]BEy-/̸Yzb6\_dgs9V 2p9jʱqُEa(THkUJXF?eeTwqx#iM/v0)'lJ"B̛]2jxjkzj92S7*uCcA,q Cv ]q2`e&{~I;K{wVvgRr=MJɩ߸TԽnGzՌ}Pq錆J-HRZ#$TXދgձH4طhf/g%';?xӉSə?۩ZsbzncC8'~J"f@ 7Gpl|Yd=g|_0癩w_xŦ)>vMvQ6^<[w~d'iaWQcR CĸezrPY9UI Y)KE. t%.Yd z/ Dك'%!>y8>ƅV1r9!Z7UBRәkh0t)?_$;ų~i=9:cOLbĎ9 (l-GD4VәnXnOBUޜo>$}Wӱ.n1r zS~ɉ77Hp(4ϩ|\k$QJO`vrhƕQ6(s3FKYrB 5绨!DM.y`;NKu[qhwXG&gy՗5SEv*hvycuEuJ=S]KChݾzxfc抨$yνڔ*٘Afv`+sB7֩CnxmZ$?MP0ɔkvdod﵍%0qx(xI NcvXd{_27k>,pJ!7ѫϷ5ު}Ml'BLSמ3u7 oQ!R企T]:ܵW#GOسu\Z"]?◘|ݯ56;e!h~^!P H6yp<ӬML?N$]*?{$;KTj[I܆E&tC@ ,0¡-:$΁ SNG4˩Ğ[q>kE3zPVZ&!a8kNDk7#eDʨHN/L?s8Kd9 DkR (xuP"wPVز'(A,PQ[ {`l6NgU k(w}j(J'?QiJA_D&;PW,Tm7~;vj(ܬt c9nO psn_6$m= j!o8RwHRl9xLI&$=81Vs߻h5J8M1)_!WWv.}zm㼾[)o9^O(s"Ϲ'oWS`5>N%WBH,tZ^! w2Fԧ2΃mIctG$QIhbxAqHRa]d!, G{yWU|/uua67J3'Iyqt?ڶϭl~u!1{B=eّSy ?W$.7}Uɐ>~>ʵּA/=Qt}:ˊ6cZzr7apOEhgs(DG k=f#HYG^y7:b iro$q]M=ߧ07l @]1!YD j0tl RߡYA+9 2>|)U i\wsĊ$~^3]$$T N` u'hf8᧌;V%8 ؑf%}=g 5)À21OлD$ TwנYڀ)0B/Sg9ސ\<` bP>A~;ߒˋ׸h3OXHscՊS?2#`8͢ca'` ͑)B md^wrj7&DMIV9i؆61Ny`ݾU\0nx .-޻إ\-0WcOb1oɭxE3=,i kQ2`{͆ߙg2e'BCуm_E&^UTߜb)4wax Grs"Bˤ7>ncHA d谝{PaJ*ʔ'qc5@Xܯ0r#Gfl݈1,` '˼0:$N+F45lCB%OW@zL})%~iɇ:~<s| a?4Ҝ.i_ gIlCfr&Z&tF `!ȕ42m|-+7[ A[%\ojͤ?fs?&/OuVBС$,/$M9h~.7F4;7m-o4#s߼Y IX>&p f}XUDd&gCP\%4|\E(Wd>P@~]/5#ƭp9?Ozb |Tc;q~E;EZ,ݨ%)QL:TQ8rvyOl`gX"Uf f?DXk3#ܗZ~PXFFhVfE)3r@t8ϰ GH҂OҠMQve5J|1Y aNp}XIEqtI\PR`dl.gdWXd?#Okkfr?`I%_1 lۍ%|\XLtuVf$x1'xםbgpgBsi+bX{wLS0jIfdsLX ~&a?33Gb$)u)&uDc~x9R?3="? [P<A#BmZ4_NyKS!թ8 (z}$Y,wCT62گCH0=Mhfiߴ 8_ $=r}X+*"Lݳ$}BMEtm68ƆH-X'Sأ@m°oApQf2=+#ue㠾MD1U4cvlĶqoyq-|L&lfaVwWIqL3Bkb@]yyЧPPNl!OVf+m><ˁqA"҆M_~.[1qɻ`/u”ӠJ@NZsF> .],PA1R1Ak.A .aHFDf,vR aNlvGnTVm D2=spY*R|]LC91KnCyU>G iUQNjq1+(5goKLLSeώV(KaYY訃eǿaȍK0?Ah/ٳ2q/saKs͎ -J:AMEgQV~nBNUyt]=kF,m3,dljMoS_fQG:Dŝ੎c^hɅ/W] mSGa}\(Jn?Akc/=Z$ݮ6d&?c^.vT"TȆ}RYW@9a^>Lh*8gzvO}ldK)3hD,AKHZ^%Mjk$tP޶6- o%eu p+!;_($K湡(gh*8KRÃx|?z(sZP1eQH+4yh+[,KG⧏3x8;GNH Kd@q-Q.J='Q鹢{{fg"+vTLb!㗚 &bi;5=+φXo??\XɨrQ_xgŸ2ANҁ~D.'s(9% Q%)ge:x$LBYV^J'zZ4޷ow[&LImՕ} 3Ĺ"&+Z 뤻ouV`"\iqoa0CjSͷvO\"q+1xLe+QdVqLv6шatɲ]f"e!|S5:O*+YտdiJĘk+ OݷdTpb,J+nzboz0"YomMYlOK^{mElT-. )񴜆5"srŁtRTs=od3crOfN}?[:8AC~,WRJ-C\I[9x 򯶦f ݛP+l8RN03F1 _{/7_o $cGM^Qh_Uu@Q{ F] 4Qk3ofZ3PU.F{LvQq s  s-yy3Uc m._f;ĩ9?v#<|ퟦfQSy9ɶF5G;l&Yu9|hD@5њ$mU.162 Bj. 3/@Vx\ ϖpX$)s;G: @-)J}ioT>}\'rp,M'Ws9"= 3KnΙ,4aB ٠V{͛CdG@TV8eE@օ9L:w_UlSLt(5 ^r|qf`4]e*5'khZ!z'SNtB.O-2gΨ[ [*E͊7N:>;>#lh}SMR u2O j8 l6:n3*@ECԑX ˥yw'G;swWGIJ 8 OG ]noi2l;[TrthYY,KoqRXWVh%_kwjߤ`g\95>Ba_\dFIANEݞeюZMvw}5Q7ĈfP;;̯^JHuHw|H>bZWzz4#ҒZn/v axųE^j:tBUzsoVIwz=Ŷv4_tegDSͬW}i/D*[ۋy8 -Qg漬OYpO?G &ől?;[2)7u1ל\" 9.xބYFaShrXoB&@<,>ؓȴy|k[gf 'nm[u*f &FL&P0R`M17 H Ʊ0eޅ>=SsLaTJMe-3G 1?T2>0S|EPZ-0?_pU7&fz7֚zg5Z˞n9^Ab$̥˖2^ԣ_Y&-E`4_!k"aD|ԕ]~T=;ºDé)$(rSXAk϶;}.`cH>ytB+3 K)4wPl` @#{h,3ݮv]qs C5D~Jד_-vLt-y٭'y)[4ac)+.uED3 iPuNph.Q(wUЊ˿lڹs B=JZ%Vޏ&3D'#lN \CSs_Ԩ';GjhI5JzT/ T/ DAEr`Mܝ7_2a\*޼vH@Ѯ#0٩>?!sסGpaWY6WVd?˿e1=.-34|_ 7Dat1s *Ld"4̇JpQ Qkt9B"hqv:~-}Y]g} l:rWA!dps6h=п(w JvGٍPe"!^aGb3˨˲ḀoƙCrL7zAAEq ?MuO[eepg".}|wY]"Xyy픰&)xȰ CRk ld;(Έhh,0`N%Ļ]`T.9;48trq,b8C1l%sx[?~M_2I棜\_2l3mt{Q`WIèYy9͋,S5E9vSrqmFӛr$_qj@Ѿ¶A[J:S%q/eD4O- k Uc#:t]NvD~ol/h)Y~˝Ԉ1{N PGd#}yfњ5]'s 䄸A߭@k a^9 #)ӏJ\Fypt0HMEJ?k*ŅmƷk#"N ;OgXUIi?m-ZqK %{Y @m)~.UUuDWFKOJ=[f%?ψa% rSb(>]އ=YF!1듞sXpyp N~fQ+]7_ !%O|I9ӳdGO$z_6pFumKS[=c]K7.SZ;A(H=]}[,NxR[ D?Br$;L/^HlΗFA:7l _`\iC/ːʧt,5lz[ E9f]X&X h. pMf lP}V~ !#eUI[BfdOv듇 $~>!7ƃ4{# dŏ]FWG/$M\l5T3^~NV> =y%R?vnt|FB˨*hD*E'7\XbV]0` Vnθ0t_^'KKF#/p.?-};☶nb\шJk"͐Hc>oO50*v }EIWQ ߂'ʆ w3ᏻj\*'eL ϝ%{l#k-Vt¹KCo` lkUբ׎牥=)Ɣؚt%R##v"d]4NHN=j^bw|"WZqVIV%&y ^t5vz; aV>\NJ<EKz-.@-gq߈Mfx2!xѦSlg!& \{r$I"7f`-7smɆD% U 5zRP@bW3F]D$Q,!X # 1V[!u\w6 7ꎡT7MSvZ+]W-X x}&/4o`7!/JC4gI-ṅV`p[iuU{l- Xl4saesv&1g[/.uwHqK)h㋔: ۷2]6h Y4yH[ BE+ /8M:GX=bۮ/K:Nɨ_['t7UE߀pu[yozȞNjlkm;蛸slu4do(hp6VLxߩ^] SYLo+C\`Y0l:Un$ɅhuЊKqo=OW[qƋ:Z򷕀_wYߛCMҩM9N~#LWz &l%,8q7*r⍟V4(AHL; ?yl@ `5ׄk^<].;c{&|xv"^#8_K}T+j"dlOAqڎJ@VD@~=_S.m2A,/{d5(̀)@;g?.: ߽OʿB_iʩGQyvZm=)oVQ}+`喇9gío66l[fs(RS]f2Sp9idyUx t.6 %9Nvnwh CTu=~J !> d#EKff C>ev| cu>IPC72Ԕ{W6>~V#8t6_,zٽCZAme_c$?5S=ݜIqWVP=!t%_ŀF7qHϰ2%|392\hN8~~H:V%|/Ln˨oW<Ӄk5"!G ,Oclb.oZbyb 6\ʞqT{kRk԰vmB%F6J#KĄa`QUML*I!4%K!m3a(X 2{ XDiJk? 񅾄p;0EO&Jgsm\S4֞b }4ata 8h׋رGzcI'q+/֠R k)̙K4Ʉ.'䆳v絗kT5'Tzfw ;BDj=+y_(s^SM5l\9ИdeVK{)i%W Ըj-L)\-X:Mح45݃kq͑ u~5 {YqN*N6PPO  tΖO"t15Uu;{hFq%ʹ. ׈7ژk}ay*YNRwaI2zv \VulZ7kv<Mg(l(2NPt@G hmCa_&puI8?BVRwQUP\wLOf[Z^8bb4mr~x~;CC'}ȅesf<1‚}ew3ƱR`4Y7ڍIeF29qe"K5' }T^)q`e0V i^3rIaDuݪ.$R+7KQW;8;=ϗy̒'N?Z|5˅6f+!D]b1͂>_#-,^'j;Ŕ x,|8/V$ Or)Rk)A~9#T6lF^␋cyyݫzldcֲ^Q+v:;U!p: !iE(YU",6qc8!`gm9R 2[I,&e-|3Hp9cqȡA%%b; M H9g /+-܃^E^:MJq/אX+#e]H^68 Z虶i=z\K@S85_n[K(Q<Ģ荧7QԶ9Ƣ]owgj#Ъx=MdzW2~`?Ɉ8+d'y+ Fy(&J \RVZ g =r6 &g'>ؾDq?/K)3;rE<#Ǩ6!"Nz-mIGr7肸h8)4iݠ H,9k^uS.r%\AY8NuBd1jGo.H̾<h/EygWU`&=ȩz-45C @qp M)!ȩR֏8fkҊ,@/}<Ǎ:'S&8ȧ hUFRܨ7$E>rerjk)|C˿A7 fnxo޶) G7[Ha&BfSGp"`>:/Z%Կ'7 K=k,rtR]iLMPNdѢ{?B2&e՛ouUHQ0Z+ Wx䜢c Tw3n!}BĵRқP g]OϿ{o2EGd>o=afzcm &e68 ~Uqs.T]ytQjv-UzɩIx {`]o#+Mmz5f+*L[)= W>2++x ̡+ bv^"?/ّsu bcey7_fƮ iZ:L;7=":;zeݡr)>2pac EI!{r?k_LMeާkݥ/ ;o64[ULCHBN)M>sZà>cBx{{'## 5v"+}4'oZM_zO-+f5c8`rM']!r an '2Y?VCr{+j-ҍَa3^| 3 ^ÀG?" ?;Z,a^r ן%3RD߾!E0!(mR'&x8rV#C,yiP1Wf:?wQ ixxr; u-x}H! 6E] O.Dw&ZE-ȯ-!)5j.§VxE]c[}]Ec)2lo]_4K;c>kX[1w,$"ѡ^:胚;hI/dY!gUz'BtCY( 2BY ?Z*__FY {Vh̻~[:G4?Tw/M(쵓D fPN v(8?5Ka:b WqRV- NVߐsB(h6S2OURr>uFQ8TI=AN3VA3 ;##$KVsh;\@h 'GbF҆'b r!%F-sǂvH<˜] h˳}6Pӭ=*K*!K(gJFKbK!8Q*5|4L cV6 i1_9'Jri ӧ4nR+f˸ yaA\wS_HCxesgzOѪAooϿz^ɲBWN2Xә /ܼ-ɔ?zDUϗ~L`ZCay?!f"{Q1^D+7a]ɪ RE(|v;vˊ0us3̌Rl̴&ez!Ө!cC۴tx>Hڔ^k|ځ#O&/S<QA3 *"D:-0][4LQeD˱ wyKƴĭW d@yYX֥_Gٖ'©%HYrTvN:ueǰCOJ)~dn(Y SR'T|@P 1!mYB5΀pdaBW:E얟}7 D( *`WFHq-7Ug?**z`VqXwLr&x%rn2X"(WVZhvg~}գbiA P_5"SLTNu➐lwBo+(/M-$A.]0qXUngYikY)N*N"Ne7Wm&Az(`,}A ܲ0Yo6iM;A=;a}J 'K+ݼ+ 57zط*!${TF5TtyoB1ܟH>--6y;ļNww4y4v("heP='H'B>j'۽3-*zy9ћ{7գk.ѶoW08/𣕍E<<Ǩ(lwVufD f b4KfߝZWtV4-]@\3KDza}K٘R)ZDo ϖ)7s+X5B&ڂnꎣ3z22 oaYUy-[X˂d.aG&XP֙) eQd=g>,U'Ger0!WWмn`amt!Pw=`'ks6 3U]c7/TtMJp%n+{G=p,e uP2i?3IΈ=1ݳvwwזz$IZJȡ zf#îB_Uݒ~'hHn[L(hq4HŌ鯐Gx :Jx [Ыp0HynIen;$ƥ:6\v(53Od_f~,@:;$QXֲLD#\7{gkPr$  3> E*3N/6`!h $ՔMIϷPV=6M?<Ɓޥk6=ܣT{[ [@?O9Rm1Ŕ6*=;_4<[=24B/YA.B*%k;s*1?S9ȹBvOЍG+7 eﵙ\=VX״t]W I+& l\ k;qIhUcJ9h_ׄ|bw(')%3{duևׅK .8n)aKWν*gb5~c.`%5;A@ƫv3-0]KLD5V9R$T("NzGs鶫 8sig 3k `PCc L.S++CEՎ$l}A1͘F=.34Gȩ~'JC~/׉= >)y_LNطd tN4 kLEǃTs >ِJdq@peꜦa\؋wtX;`_@;K4̓殖uOO)n><;+8{vZJa1]9kdףIJH*GRc뤻ܷoT;Gִ߲oE"QN`3䠄Tf(.B3 1wW-u%sGվ)`u$"֎aϰ0ӯ4\=木 Aqw?VW4|}%c-)T}!ɺeJx7eAxVAs{t/XEԚdONo~Ww >?(RJm˥;c X.rU  ۪6 MSWq6H[h.If<"d׎9ׁ) n]phEі*FOpE,pG~S|zkhpu@x{>g|˽`@ނN Emi~gSrӍG׶@n)-ⶠ;uHZ6hVYGO[\D+g[ Mʥx!?2jmq=j$$J9]d"Q&jw_԰c^j]X[;dX$j:b!njKJn *a5Pc iG#MskUF|mx P4̭2%Qq7E~vo :V5(LƗ\v__qC8&}65_Wk逭F%,A*,J$ymnZqx^{9Yg`xp{ycg!%|' !,o,:RKd$:ƽ3S}ﱩ25{Sin .?L rc,n VySlR K 1;Qi9jNDO 8ćoz'"ɡseF#N""(mxy&U֦.H3 kؠG_H&fLS 'EŐXo|$6M(|.)VTh 8,]|*!*.wQ!z> :[*G~OHN̰ӁCΦ%ffCM!_+AeR{rh?U+@A):Ǹ-ωZa7~7Oܐg">Ȑm渕/gͩ6祀cZwu_i|+E*N"7'TN!SAn&wp9y=ض";xuս(ﾹJ,r`@Vٌ1W~+1GuzɲZ'' [JD rK|Lۿ9怕Ctfsa֢͂30lxA,=-&t!U%rmk$Ss8ݦ6v[l8ԏȃ[qY4ȌgfYR~w\b57lr,.ܥJŞ5uC.2J? P9oIn0O ƽΎ]VJp_tlC;?%@NV iYJMJ='~=g Qُ\^O%_$sG]5Mk&ea6`*^VШ= fctE,(W$MB U{RZB:gwbʪ/M'E{4j(6W09#X85B,dg_@ЮdP a{h_Y*. ^z*/,Ě>ja@6hXwtǢ1(Futmattȇ^i2GŨ]:NpktT^Y_-&g>TO-)zSJ9h1F[b]%onUp\|O³b#T>|kITt嵜.6@^XUIo)< %z|MPZ12DO 08 CuQ%.UbT_?03)g Nw!2)o!_c[]H`~%"xA4 v2(}fΟT$ol4a/Uz(i=6ACb?1]a:>O1-Lrz/Mstŷ%JWQ.U'gv4p}@T^^, )[3le=o0/&(>g?]Qxԅ3}il- TGF6n+eP-v) Q|.)yuhP` *y' *-͕{)|/X CU+rLWj ]xNIw1#" |=?lKťD"+MT_02SZ{yLM!bAնوVI{0y?6Y&CpzhJ_HcYKf($c{oNd;kAZXYr0]i='mcKghjxRLf%o~>:/^KIbmn1w9ak W_N84bw _(A&27% ?tP> 9:2 )dL"ϨEY'Da sȝBWio|3& LF5ߴkķN~&!ˠׇ5_h,X"v]1ʷXǂj'_;ldPŝ2V1(L%G4a8옩 'Dn?\[Nt= 5p0On84/28ד6y]Yt|q7#oI3 ܎0*C Oi;q/:o祉2 r Մ\T[ A8.ȍtY  2U1 *Э 9UݕmyptiS?$3 1Å4szWOrqxS ., ILmIZF:;)Cnt;:?}][k۬&z*|'#-DQhU %͈&Nպ8sW@9H)iNБp4]Ni**.B-]?ѳaV nr!NFUQF7tfPB"Z%omy-˳jS5uP }*$Ֆ'jGXļ^HJͯe)w-?17N?JRseGF\ ة4&Q 0UBfvi;Pg9.ɵA={`(lrMHT&d9f H*ֳ [RZ~'`2k ̤owqt4h.#u~ ) Sh5].y%< -6\\-hJ7Q,*W4Yb+ȑ\{Oq@+Ϳ6dxj)7D T;mzZ1nkqrnwd /Ӟ1<6= =]p_\s>~q7QMg߱Vh3o".μJv,`W_]0|eF'VvucLk͗jxy&0L~Zj% ErtO0O5<2LqEkjz?aAĢU\]4v$Ȇ`)lIx(n?<7zׂ4*kw.TO/|Ѕt:+$&'8**N{'hֺ6Wa?*N}mƃEFH?? WڙbfZk? Y)ςY%Ilx C6Ur i .GuQXhw- o ^?ď%J)H"Ez#P[0NQ"v~$vX!GK4QLKy=aT񭜕z֩|O *=ڤ:oa*_YYeR(Bնmg9Wƽ  ,vH2[ZN;Iڙ? =A.hsȿRM`ڙZoaƊ6/8KO m=Y0 a6;iA^pZ(i*. ƳB<O#o^\ūk ?zeQȠ^MX&FD*c:\Z2~hg:@J\FSOl—r@T'&{(b}K=+zn9K,Pc!YK*w>őZvf^C~ nJ).W3Gp44J&NBĨ׷qh+B664A4P qJe>`4u|}HdM`lթo.ȪeoBoА,JHdދRU|D-V߅0٦ k} A湋T#b(c)BAI'pp%۶-SW+3dgƙ*&kOn"{ ̌eul'a)> *=~Ʉ!l٫^_*cfSx5٢*Xr,N/tZm+6vj&}ۦ=ӝzтRŔOqJjCA%ݹ b>7kAI'GnX (#K{hK5h`bEu2[f]^ cXY!ΰ櫧 g?Yׂ€~Enp%\Mu8&*^_ Z4MܸYaX 1q.?@p808 iJ\~T=Tɤavr[}NJhx0|o!HE1-a=%)eb9 I@lU%gyz&HXd=kd> ;Q_CmQZԍ#v<'?É[qd:‹no0e9UˤkvEj/;G&,v2 bo{dӯ8jr*,0IjJ"v{)բ2Y$+"9H LTJ(b|ևVqVUrQ`-rqj\rИ4z+7EMk*S9t?@fO]{[ pG#.A(MC3}$lq~VХ&?eesG(vTpV$b+'2Lpcߜ[Lk(! I,̬\^qfA10(~&u,, 7vhԓ5 $ Wk9-J~(4(@C?RH'Őڑ&M^#c$1J^XJӘ0qΧ8HaJCCn<^U F9Q,;5G'-?Abq O =PYj{W G)+v@v@+һ + Kk0:%b=ZQH n>Z)kYn's/(s)_ RJqkپxU~NP~&3'  )_Ak1*_?IkRv/^Ke/NȐCs,R=29n*F]ؔf9Fܨ`|*EV-'¿+Fx&zK.ZM֜rDMS7ؠ3FoF5I+#njVd%^v~=KTFJ4f5ގOg}~ԙ =rNN|MGqJ MaʶI )0= $~ՁIau}И+?用Dc ^ArAR G1,%mQXct|`LFR­i;[5cb:īI=#>v~]M]d0 \WB'ޞB+EW@?egrp[}uN -bW?;1f>zMۥM1X-^ˬF>Z0BnZgxWdɠ$Fk} }A{0zP"XSD_`.7I[d5Iqd j=DDK+`m5R}wp"Gf&!?g;PY|ſ6t_[w[? K*u?ٵ6Ϗ['?_#hL>+m &=@i8\0[w]:GvtH]*;/5 21)$ϣTX2FֲT6-Bj_a\cޘZ7x.+>sJF[ܗAB0!:-4ڇFeǎ5o0%:jksx\21<&oL>}ec&x0vN5X%w{@| k/`nhW/B08xl+°H0q,*Uq/o~i"HAAW^SuY&QPh*`;FX A| cI0)7݉Pjx sҕPK+u(4@PA-{p\^.+&E.Ýٯܖ I_"ͱ24#6hQѻu 9]'$`;wxj %(+$85B{@gM &-G]!GԦ5 "tmŧ?p=tW.g'49#1$ ydqG&e_&d\EnԬ8*4a&1zJ7GEχ R\%3%'PG.d=f7Ym ePxO,KH0c襯2E 5Dm6߫ hG#&|MqCbvQ,D8d&6n "'}CY9>8VpVFE Pt)R[UրMq9z* (DE0# (˅|ٟO5 Z~-)UFd S1}>TOQհ%m@rY0T`ݺz_Fi䞾sOT#@p=8\_MJG A?>)~,Hjsu`0Wm)S#<] |` ^C} mYu]DI.vMqo Yhtӥɦ [bbpSֶr0BK~K7Ϡ#tͣ NImBb-gZWI_)UڃAq@Raְ`Vuſ/f$ipqť, ]H򾭭j}Z ~䃨s1`hP^!Վ|f{M#T{|@R^([a?)yc$,cqa?N 8\(Y/x % QVR̿A[gϯ/X|y$!SlZ_= j `+Pogt^٩'arcN翵FnC<˾S[-yMH:ڃ]3NO_fz7l1^7#? u=v|gdx87Q!Eb&Ԏ+Y>?$ɓ; ܟ^ 5K%W 3n / )ye2k>u.(@+}w]j)y=wd8x2 㴁-)U7 m0Рp+[ΰ.JD*_GN~CFLѹX =)/ e0ˌv50tBsb0xY,$9!~> *fB o腰0ޭ^F6>+dEN#J r5޴]P?o2!:0m4}~nX˶ŌQhaub0=o7M7 &tTޢ1r5!2O \6gz* !C[0Y}2" XÏ=Y fjB`p=W`q]nv87܏. uס`"*; rSl>$8m$B˙]KLHf:-[!:4qF!p r]_%8WIDLgW=w:)oD$s=jGBE'Hvxhg\%2'\VQ.+Ϗ[rW 5įiFwʯftm3PYDef,oӸt|y.J~i>(! i47OdhlVGKˑ5a,\v-c/.?{µ @BdqAa!nRو~o9ْC6^)ϷF.̲.*b*Ȳ7fBmĀM+h5]?Ћmh>5x3d~ 0yU;/09SIZSh3GΌWR& ywC.4VzZtdg) {jʏ=M)rP̈́+LTiQU UGO~;~Jzm4gxq) ps8/t!-Wֈ$ܠxu3F!oWd'0rS#/%5J[h7[?JΎ).=~vޥVߍC5YP:eo]kYdz:쳇QK+hr v8pݺK-*|Y`4>[yӈr*>/5,gGO;ĦtפE,([XWDz瀊n<o+•;=2&|@rԈmB6KNcH=2 n-dC㶖HIe;yc]&al|eXg!:r 0KcX P:+O>lm"œ=ծ?f3P o$ e`ie&?a֌z]cH $,L5?BX;0'N<ҍفzӢDٻ%dNbruRm fΔs2Ȝr:B"H¦uZ!d"`#UiR6/n~g(drjm],t>D&;w:wx!bo,UDb'8>;mu)|kc-JI.;$QA4 ,Ry afork{ i]~V|YNF,uLLh Jrf=7.֡ t%gS)\uhNү Yl.i(Qے^ B)i*R&f k$_R uCؤZEGfﴂ:Q?W@{05Dw1sÂiv8 w(XE+U#j2\75;$߽Caڵ׍;ؒ ̀å;ِiSMȟ[Xٍ?[׸,#5ڕZEٽ|]RzsjTDEMW/pHQΰcqBli;jSeH>wDωك>j˦U\Bjk#Cs뿏xK;~00w;[\9 >+Jt,t}ś6da4h;AIHDoE>N=͎t-7xrg$O7>B.kp$;(PٹZMgn| CݐnG ghԴb׮spEi_%!량-J> OD;KQ)M_76L w5"=pSV2^K/ZzΥ15 .1R-ٌ0JAtՈE`;8lcy @? 6O6 SLCoŠd@]nTp'6;>^ӆ²T`?g]Y| TV#vԙK)[ <22xRL"'R u|J\ x7N H[[J]ZSRnhePAQ $y#֘,ʄՕ&`ykw0LG>Qp'NWBS]/ $7)zQѕ#+dD=č@|cE_m#앵&ʌ=q\G:'p _m):@1gڨ1Uۇx *̧&V0Yp#dDd?Ac}#Qxgy^ OKԛ2;]e%ae!O6Dwlr*elU;WȮF;I; ƠL6ӨNgr4#w)nO^MHlB<|?V@P.'Sl M\k zaj Z ږ`wu"lzQdHO=.~>v[;Z# (0֬i~=޻-g'\or]M7)~>8kq*/p%b#/^+wnJ   f}`ׯ` ĸSJ) 'ab=JEZ>157{9nn9K7;&t\Er9|cCv=/oFNux׮̣XۇK_ԡ%C(OA7#h+U҇Q~T$0@ (E<>^wK[u*o1&Uh ͇[0ĩ (ܞCƂ!˨ڪ+q\>{ߥW-J!FKD9gAY@.GI~~Mpsm˩+#UnU/"E3ic)ՕO6_h5/=>J*Z3 jMe㽟iLCaj]NI`ą@?l<n۽*[f85.\*+ ?S 'YN*<`?phpGR8D*E89Iu; 'RxcO aKHkFyZ+flvS=a-SdndOSNSLo,&l1Б^LKqBqtۢ3?߿J߫W?u&AvS,q'DDy|; '#qi+rQM3Wc/d1@ZdKj9Nwof !wqT08r2cphfɭyȊmv0jgBϣf+ CS\_nhZoh&֋݃ ?~qq_-_ r2ē%k97t-Nh L79AD([8jK2+n6cY*'݊cӀ}@}<(FRN. gYԙN5mF..~*Y M'jq۹CBAθ#4Aw+&=s҄)cZş9 Ui+rT{Swq yVI'aXvy0#C%>X"QA޸)PsP-LHjPwiH֚^f)$vXׁuWtC9P Ȟ9]!3:>GS \ F\  &V'Yn@ ܅.%֫4tz_͋9oݺC2y?Y-UzZ2S&}\UܹRT7-8O 7Ζ:~x闈ːShY{wEXY2۾-ttE#WuF:[1i%w)l%3`U"`Zw/i^EWxTn;W s0(#fZIdM$/.+J2a}AeG]3n_!A4œ\__13- jy=3dCKeHLcU|ås' K"5v$v?@ =P'2(Z FtH"vȟy^oZm+hr*@}+t}x_/gq~ǂe&*,Q i#y+Ӛ Pn\Aq==~ekܽ-Z&%4A`hvln"NVyLG8 ۿq#YUrSH;eFܱpI~a 0 mK %.fdcjU(C \NiIpp~.=Mq$UcOİ 79By3:EJE@`F{$Y RWi4hH6ʇyQ:@{ M#s~CUwdRuP-r4< wsOA?עZk- j :vASΤ*mn7*2bRQ൑vѐ/{{QbI{7eˍ2+dU"гL4BILYfo.&b9NO%bv<ܔRphm[=<{0Hv!^] ]4i J}JZ(T77Ty-] L%Vr q;uPAyyLP_}o7tt܄A)Ruqs\@೶wdbv |IHG~9OB>D86, EV%&, (mIOAer">\7[BZX NWx8|c*xHo YZ|} 噞KCmʞ=oɢN ,N)&m|qk$W:ґ{Vks1Tҳ|R~4s˶9Ȇ53Ky& sߢ ;@'fdiynJ"1V8!˧J5CRۘnJ?s]9#uCBd "Ffz#?>üҭX$? à҅|'# :C&`jO Ӣf%;Oɧ Q :  >o$d%'neمZL8#?Uҗ?;Q$8"%f2$D;kcʂǃm!W̓< ZuC,S)(vODQeJW  χ1v[VqcLK~=bAhy0k5L2ELBm(/$/Q7sZ`:\ g~6ݡd#bK$kju(&%vioTKKlkv*oGfpLL7aP&r"{,{\gw*]9>-[0(@dҩ嬑boX q켴H%a =Ο8Wc\1\:UcYY4 ACYsZYFG'ҶC`;&|gx_mg7 fIΩ޽Ok7!ÚUGW kg6wDŎt||Vg%XOC>fuF+鵹(8E>uI-SoBmgƒ8L~ੱrL_ -: mJ wd {"X#bW zR_,HW^k2s AOtIA m7&d0G̪|=|b#K+5:\@%6KB^b~!hf,oӧ{{8_ wPam!:^dZ0HOsq*&?fu2%[a;(f|+mI {֟:ʶ 3Z)j:3[$xo.Om@d{GNF4Y_)ÇU\)9ֳ#?m/|^HEW+DmBbء/Crt`\ *?Uzb??P /HӼB3̓Oj$&'xaDa 6130KulZcj&QDϿL)N}Ul70mT[xJ̪%昛<ѭc rPx6A\ґӐ n=pԎX چ|?z\)R`bɗVcU֕@`u_x̑Yż :ppqT}YөzqdRP4'DYl67}u^ L. {LEH_:' k20Lߗ~uƽP(̸N: ;NǛ/CrH*sxAV+X[28]ݣ.A-ތܞ#P@g_ ^ʚ_Z {"C&Xo ž2Z- #NjvxW3M,!Ce)Ƅ8M]K2`B%NYھ.;4, -*Mk "->bmE[Ufy$yM`p>8v3}?# [7@>9;Ai>.3u\dk`|7e[oK~UŰS^rg׃ >bz=o |,=ΚG`XZffȲMpq+؀wA% If/ %ĝY $}\+&0ulr(>okYndXGa e7 =Y.lQ}WG7SP >jy+0ҥYwbܣMo>Ga]6rT1 :k4yz ?9-OLOVLpE`| K)M7w{f,WT;EFɅWnDf]J$M#Yp6q%-p^quݑ&0S'`zj/Oyms'<`-=VёMmoi+ 7A?1q9^P;idW mio;B6R#\-ɤZ.eET[.Lo[}^O+f'b&.VN)E/V`ǵyOPiJ]_HyEN|e.Bt=v˥OodGpn/ɢ$Ӹvښ{X<׋x)M/{l>a2'/9,Pm I?mx";LP?8T/34[@[ !aږU#=ːqJ_DeyLg1^7׏).K5F)zen L0#J+ub%aBwm<ۉd!<ymKq?Oh6/Wx4kTd2&=,~(,u*NMsJ^ rDgVShp 6~z]xqY `z8==̞ǧG`|g2IRH\uYDljp`j6)ӻW.PKcVRY!(~ ~SˇCI>=R^0Vl\\ 8A]Hѡ"rC =DsW^z?ەy4''d8jh:a>VD&k/ )ōt GszG5َA_iLHmS'6~1 4QR2ދݒx)xO@hS &clI3™ XOZʺqh7d9V!oVPmY.6*,e&Zmm^4ttA gWC926h!8L"0ɀUeRԭ 1ldI$w\J&7+@:Wv LQkL}f$L&mi#¶5e0G dh8?>$LFV3ݭ9RfAe;bY232]Yhbt Ł}`=Sǥ#"g 8oxf z߽B7a/cyPٟk! oOMXBJؗi̸Oxt=I*) ojA S?.,*cNUzA#ptP-0dIEٻfͣgFunh8t"i21vW$SY6nμ$P8%8#t?ll69+$88)VW% nl& tld$i|Ne` 7*y$.lZDѰ? 렺4q?&$[ٙFvz .hKH?@ [WYWBf*UbsF4RLN&CҲՊ cɷp#O Ip3F>j {[SL̫ؖ!LXx>Jx7Po58t+B7"I5'zG3Ok5(G̞b>;'2<z@e #HT} x봭|p ,-t,)Z0#jN|u<0esS`f*@4?oV`>0+UW%!m?/,Xһ 5Cz bTaB3g/êta8ɖ4LV(KT{<9kh>~8`CB)nkcmIᩃqPt7bޠ1[% aj"wXuǘ!f 7>2h1>K(RUɁ>ӏdZ#4L2׆UNԟPe,1t1e%SgHdQD'Zz4w n3=tͯTb:\|%!s'IUЎA 䮒n!ir=;^2хaVoJ_+7T_AwWx@њHջ;X3}D2M$a< &Z{{$z=|%'O_]~tEy,ԊMOvR9&Qˈ3zHgh 3vZaoո)M/_F-Ϳ1mhc 1oEt-|uu ӫȴ_Ԃ7B^ ib-RA;b T閱0)?GMJ5r(GPֶGxe}1HPm) \ă]pF8TpF `U1]T*;Aɨ}%ĿmLywkm_uN]Xjɜx"j6x _Ƴ`Jh>sJXئF JX.=ҖGu8Lٸp^zo/eJp0lָ9-_ ! EpFzouk*@“]r`3*2yhk%%jbhEտ˿b@*Y6ŋj$y{үqݷ.G3RW0B>wUVZ}WtD5s cH87nJI-fn%^ZxmEGhGTr-w[-Fktc~ xCez&5ҽ<|1Iom$?pE{{ ᢺA*99leږ6 츶t8ڂcs<9(nA9ܶ8CƑb/Q̝xy&xC?^%g$`+L}ῶAsBN]tmkWXAv} isyV"2O<%(TňVcY/i6Ve.xGiTqԢtSh7Ħqb4ɣy?Ci=WαU|!W/ Pn:×KQNomZ1'pr^&U)ex4dzyaMR(bm+_jm[Ԃ<#`#+RZֽlt{n/tl/BWq> " \ȩYL&. ;4+NU:vfc͌IeKZ9JލW #߿^-۱ZoR#Zmss,rkmkdW w6+ֶ\ʿ慐W m)]D qrO.3{h2ҋW v2Se$brG` LolJy9ϿH-ĝ3Ԫa0:O4 X~9; Z9s3%Ddq95~8v@1ʪdy{_&nm_aN6|zΜ٩&Wd $6ݫfyS HOb Xtz!K1يr9M%w"Xղ ,4HVUdtS*P[󲠽ؾTn8#(otKwq# + h4b3l5M$dO&ڃDR_mf P?T!:\-wii@W4sCK?z7'5VhyU5FQp{Rպ[jBOa҅5[e9~kkofm):!88wt+b3{mC|vrIar@k` |VoK9[ERjX^b< `MՕǒZ&&R Q sJ?&:*8%2KM1dXr0\)x(CϿS&0ff#Hcla(!'hscH]vg>$!L[ZR/ FUw*.[ D/Ꙉ rIy \s5z0C)}ꮲ^Az2u0!g$∠?Ӹ,әmߜw^k$fi.E(r Z"lrCST\9M>C~<2jZ;>diWƿH(~v Ey]o@'MsksGrOnz tƍ蝞 ``ʫCƌC~%/,o1W+W+oӧ.Q\?׏|la&(:||Yu(1 yҔN7G ^E|oȗ!5[?3O^4ODPƔ$ʿ=cf,٭9uzR 0=n mXW?.0o q0LHE5BW+iX盟8DmIrI?J l@ŨH}(ZbaEm_E'Ec)Xr 4&Gl/Gk }8H#n G;qF).ѭ'^VlO>c'М9bU&{P->0U" r#rG†k{~2zjRʍ ׃u~ӯ:~B\nCT3@jaQ?ӛ^dNă}حGP5sd>`.`p: rPR>-PؘNClMFϽ|1c =׶y(#4NfB(Le)Dք^Ǯ^t+3%a^wZE/JpT^Fzק>Iit>d{ 6;l晔;(A?`:第2H⊅= Ra%DT%јMMy\'.-)vyRKΣƱ9wIJvQ;iB̟M$"f\b)]i\ܰsc뻈XéLex!P"cP3gD"a-m s%b¦ ;)Ո|"?X" ƀX M_MuKDq o3 4Z2yoA#g:cm~'gU +F=Ch !WʽGj{~d 2 {?ڥR򑀇* X^*;j\My*MU$33~c1(g=e?ju!ʴ<}nEL(f"?vPA){Xo\i Qc DPDyGyp_-6l7c)9ͻpM#L&)u5o359dn!^>zNZ/bYkr"z ~XEgOBwt/])z).qZ1fg,2-vť70[DI{l}ݻQmfhssxzvPz}JZ@3O Br t/zs{S R"cD_gL;`{$hSjUVt(+2`!ôpy:;/Ow {,S#/M4P+>|p叙|>L{hB9(4ebD;g@bFcAx[) k{A&c׭ta-Ը\1ɱ 5&<²4r? p%GyI0/J Ho FF˝>щ˂8!ʇqCs;Gf йaX9P! vA P1->} *I#iZrN;G dV'y8ϕ=QԽʪRcэFp <k0T)Dqq̸VQnD8-_Y:,-wƼK(˃5ѭBUslذz_y&|#:i:een`&)Pmb]Ӛ:e'j<'>L+wy=?YqpFm5pK9Ry43e2doo4 3+`M5JсvP7*\k̅ y[ "&|Tz*>ܤ劂?jrP=B-4,FnPw/984< }/#X8GFGr#[D۫_]'#Xpb^T=͸P2O!c?yàIg 1Ku6i\*ɦLVzɅR`uwM\״V m܀a?E{ ఀ8LV/4saSfȽaE{u?MpNwI/?C ڃ`x+n*=? #G6\ӊӍJEtM;FS8> Zi KF@cYyKY~Gv)S?^/_Qrq\> m ]muv9vAJ)WG/L b_=e$zHR2+{ȉacm)ԭ[fAԓgLd/* Ɍ#5N;^҂a -U2Y=PȒ{'yqf֬zH ڒݒs!pneu!~ y.Ľшs>؝;ESIM:`,M=ݿuC~6sJ gK0hn;ѪZNPشg׋{ p45Odش*`Gg!؜L?#oI+ '(c ׊jh$Kd&U*/s}A_dX]}ëNDM2X4" Mvdc ]Y:ZDfT]Pc;h4!E{J5α@IO3Uv.FvCR~ycUޮh`-3'R& ox^AS/,X- p|ziǜpW0>٧B9&<F 6:_-Yy7Υ#+xv${4?")ÇDgY]nI"1I6dX%. !s:֋Gq7spĭ] ]87NKΐfnQI2(HiWpD[ֳ` *#x%=alA#>8RZkMK3`> ;\U QuLE}ϱܪU0Y@vȩعe*[̌3K2Iu&pjVۚfа!,RjF2[+6P MRFH6%"4GN I 忷jww2 ePJ&08N*edyNU0:y[![e\GYf}7wA?'M}j, JBB0zdA}H:\+I%bYZ4zVqp| ƢF1]|(ip `DeI"_ـh0a0۾rZ< Zl=d>a#+R,LMLs[)x1AA|:,UG7n"-b:;HNAuOH*x0 /,pIrwkYeJ("q<5_LϠy _qۧ䣮I2Sn x ÚLۅ,1Fȧb9_X9O'@Q-S,BϤ4(R^6p"v {c'0mU'&SBg^ELc=W-b3\Z@(z C {vxNGe;!PCZ`G^%;x`ll3`<o֔lqEɬٶ&C΍\ wÜ+68q t!;ַ t!ݢXDsۙWrwyZ3za"(InIݒ&!&"Jt[|N-Y*N6DHyIsX ')&oO JOP @%"`6F)q* ]\քjE%;H^LVx04Mp- =Cq- 1EpÓM=.=?8V#k\+VjEw'aIא)SvԷêWUHQ-޻p TP%'hkA𐃚k,ki3yc*' u;PM.(cA"$O7PC:8O h kWEqsCL kvc~Ff~W6/xBG'vNXk~h!ʼnGcptB&' oJU!DT=Vq`J\@ױ՛yd2u B˨Q1 =%2 nȧ!rFT!& .3M\* /Z7m.zXarJ g8{F [Ԉ dk[H;@{.y><~ԫ<%*Nnhz$p`Dò0=|!p-p9,) DE{  jĒw[$}B|ssJd\DfҷkYЌFÇ#ƼP8c}3^8݊bRƶP UPJf 9öϬ]$_GJmN]!ˊ{sAǩb-q2NS];YӳҪƊ8SؕĬbP:<=t񰑠rXJ EC\qX8&gԀ7Pvz.-颽lh4+gtn>E3!O3NwkMCR߁c=tvwaoxSk; K|~|٫0!_\:1FBTKI-5.^+2 F8TXt5U^%i40njB#}~ȤFk=f];ltElpRm6(2ʃsYLn!6CIJ/!r7@J]jsM~%164](2":N{ip(~/e^pu_ E[˱R=,R!zY g,SЫ2ă$ Szb$:˰%F{&_QHsl8ʔo8>*Fް*1ú>uSYVv=̕9Ho *퟾6 QH2L r l`LuLO? .2*T_v`܁|Q;T=~z,M0L'KW]|#6f>[:Sxƣa隭5s3aa-񃀂\"C0n5P9 _6IGɏ`E [A9۔dWk+s0B|82xTJkP#KLYx2],I[$-my:h(ť4gm`0tέ(x~ GTrbT7>UcEUh=0*h@?VƏn%i@gB29A~, o,aLa1!vfh߂cpOA& P8V0C>>_& / =K !m'kv(gPU28ae YWfF=iZ1l*z4̍~voƓփکi/+6=˗2랭GX b vW(Q ^Ŷ_b Vֶ̏l2 ~13xPVT$#ir:(A[9 &hQ%hh 6ɴxwWhȾ}Q 5nyq ^b _IeX݆Z~rQ6|>Z '6ԁF#T :2A׀q?_ןGq#nEqY㔿 F(x a˨`,eCVAZCVZRu{yO_C'}D~~y@)GPN룱ntog M3C՝ ZK5ovGFy[I"W(r.OJ+Zrg?mL^NulA$?iPk+L y~Þwj`44[1Ib07"-J3 <uO1.TtH_4fq^Y,";UȘƏ 핿E!3KB@Z2jhh2h4j$WD}j/2C'EtY7S*p?MdDr 9ͤ]ea3C)jQ^|jXY2H,S*l>daj K9f#Ο{?;q8 lP&%ץ>"QLU)޿tZ =#:ise:_&-гs\Sz(4GizɇȲb8jBL:v%h#,AbїLpjE[ ^y(fWQ&a9m* FwT\q$DkH֎J(GD4]; (u2jut2l ]QHcN܁G)L*~5qʆW?g4}i6s,#bmwr?ή;(^dQxvf6"h:y;@0ue2F[z~hr! \ ,}N'q:wnsaM3j/eZ )`ȠcKwk!%#ms5d-e9!Bp([V}j2m7 jyHՅ҃_uzl4߇BYDG'v2`E pI#mz|)NT]=~Ih~`a*x1'wllDZ`'JEjD%۾AA~MgYCȞ͕Zߔ1eopM[-A<mVA#elSDv}Z~w)F);; o3@oU|U{02rcˎ4J苸:yާEl/iWm e%7lP˥8K_ld%(%+GYj8uwǣ/}Q)q%>n%>Jfn%"W$H2>/ V^bܕR>>!Xh:aHZ'm ۭ&Tx*юȕR@aaUy;4})aZO`G8˜]UOC{>ѕp%Tu$<) †Lk/.FO86/x| Rӭ4ˋP^ @XiDPb|/ܩxH !>D%12&_ )J SLYJ ,\/l lƤ5J;]#/|BJYb:X,^6dK,Fdי*?Ea֎ZM۔(kCg햅G?.XPO*ůazJO>H3UVaGحMVq7uJqon-C|_!k踒~3ޤ F 5|,$ cQ$P s|\Bo`Ӥ 'RqNֺ h0DvAh>X3^i9v\McX ;YZV,`w jUG?wP3F0}xm&<4-0'1kn<#g3NSSxՔmXb /Y+OC dJ<.7JRX bR:Cn% βx)ɪ"Ѧm5`~kv%f"'M݄p`뫅l# tjH]3*,W(ҪhIz S~4+ڣFd2Cu @l0 ̥Gl ]wbٗQ2:[ÛҞzp$D{m26_*ɓ3nq|>,eBmK%UhiKf<25APb!iK^sf@ ѻHg H'ѳVxp ĸӗ-rZ?#r7 ː]eہ1Et Hr-e󐉰=u.-b۝pD ay3ߩ\2nf;M'AG=cr^j:[Tin#Wѭ `S}tZ84G$bS:JA9e,+gl-ajFMp<ݔ!MޒanE+w9 cgoǨrp.6Z=\H. J\w kQnmԄq4.,f{R8xsS2?47DŽ})~)=|\A)aug20BxL&Q1߻m-Y'mCtN :r VJr5M_"^VϤI:$,ԝ=hT0Qͦ(,ꫩM n+V XEAo,i G̞yRfO]w?`pNH=*LЛN,AֳmRgb{s!A渙Fa`£.o5s֋{N+V!_JI+#>qDՒWUJT.ZTSyO;~4X6\&IX߄e, V[j{JqK\gıo-e1]=ri-5ÌP1Zt0W{0qy?;[ɨS| 9oB\n37hͱc<؇[&cɵ9i D!NXҐY^yvUsDK-3٪ypā(VBxaIB":ݺm/o^0fM- 7}^SnH7;o+yMCkV~f_ՔToާ !sʇ{ r(ze%WS@\fI!'R32'xԎ2ita _7DMe 2Ӝ"#ܻA cH2 @OiC & ?/1-v6oLXBKrʳR)P񚿕10v{hZ;F-v;MTpNOPKN:6kTW_}]1nG!cY}4 3>]AmWRRQ  bT^HMڀFX/D1⣘(ޜ+j<>$2@}6rSX|@t ]vpzW礆[_ں"> eFtj8 H cI#;aY򟡟"&~,t!UF/w ѵPmf؛ B6w;@|_1 IJw5Mu96xGu~[eYS27Hג!-jLKsqjARjq ڙR!Ľ"w QhDy4n|WFp +"pG)ȁrT@72=%i p^%+;4 uq6w@u9f |Uޕ#BGYC>%SmU-%y sL=/H 'Uxh5x}6 x!.\;ơEA ޥAon&1^.#ө 3"y- UJ H_S/LN?b^9KG8cCK RR & kox/7CSCv锣vAꐨ?d4ZKZ&oG~YX -˕k 8 ب v+sM7t$sAB,ݢF+c;7BBqh_}o,ilAjZnː } vƢ V"6|MK$v5k0M^t+F`,teDwM5neԹ/gaG4I5]-t/XKN9VðR_RUUvQ OI#!k`ق"A]>EBt3PdQ /Cօ|X<8CԲ)|#Ms)mP_Qg0==ZC"D򏻫ށĜa_S'O|O|$ ~2,)5K}V*;by X$1,W0^ZP-XKC՝" _owwhl^Zm[/~)ڼ  BEmh2^FqjU6K#jZAծ#hQ9}Ox@&?w^up/jQ*uR% ƌ562j9K$F$57 :BAlezB{L0Cij FR:Z,E2i_޿\RK$X1Jj"dMf+%l"4أw |?3/Hh—Fa?\cRO&ݵ.N2^wKQd/\Ad8oĚK=|yˆIza⏛ 4`uMWpq/o GwriWhN JCB]`H\~nj)LN= _~31ieHyǨ+e6=#ނk4>o|Nw1I-ԙ>.QK e aMO+J@n3LֺQ( \|iO{8OA;<JþN@%F7M~w|J;IG |,ջ)$kbfNO =<*|M$ r 03e +@2p0%ب wNiUYrx_"("Q@e DNʳx¿H7u/,HYII2ԛo mهzYK &4`_^*<f'ܕpU\H\ p`*D>ט:]U&~@_G6jlFz;B 6WEL*`֪m 7U=(ӕq&ExNN(ы*w7 Ha'RBcrE49LH\ I6Qf-hP\yg- ±@Yܮ=tߛܭ'>:Yd3Qelc+E')ki'#Gpon ?WU@Dß]k^$]2}8KZj4qBo@I; bir<,fr3]NZ 'M^8¾/[jLR:.~PD0 }tuNgԟ'4ԡ&GzTN|{1=fo,;Ǔx#1OwOwNިHuǷB*yx\5nlwH)S$ecֹt~)]`ܰ8Є Pv(Auգ2 PCiJ-W,૚>o@3DWb{֖Z4[xqf=( $. $Sjb%iEڼ+JctX'"fN7*&D8LLci8גM0! @-9P^ci2` 쓩;^XJ:]ytAcVm j֒MdԤZt=엸ܟkȟLt/A4 6F)~J RڿӚ70} X;m{ a:]Թ>^̈́>' Ra+Ԝ!>74yi޽Ps(sI3aXX? K~(I|,jmIeƠGj|]% nXP}˫wL 9 N1A+Jw(wh?i˥{V$BY 1*H!||?OU L)FuM,l #hPp!q4׽ : EwPҸ&1;ߌbӠ7P\SIss1-DCu&.&\d[ 1È쑹6\/KAY1&|%;L{?:5b긿flzDOw+FwbRoL21e)A~`×|}ʰA|uɓ̸Hu"n!+а($$N'V"g:1[?;X%6{UϠvR1(SԈ1 ZEZ”%bf\ r9ǯlI] nr3F iEFEnw~5li$IrH*nֵP}S,Ϛ'ד8Ԩ+n`44:ٳlr(@ÄC,F42A.ȰT{?xE3+79v{)*b F`IO7gvz#(l}FiLG@bp)D=_tg_~/s*a gbj]LU 3Z&ڀA|A۷UQ?SU 8+D}^~']o<V &zOK,_'귞]z )AJN3@>DnnT:ޫӹǣ"PDJ_R,+3Äa]#gd3Ūx Xƃ,y6~pN~pGKd+ ho ? -!6;EF0o ~zc}7سc͂z",gƉ%$|"-S}ѺΈHXeXKvWEarLwNٞzY>v@gάEvmz!kv@;;Qߌ5At[} m$g#55 pT8f=\m0T|U tZ@YsMd*5-, DŽn`~! B6rl4 ǭHy{Ю Lmm {wa ׯmƵ,NI; _C֡FΏSPҴU:4ʫkx5ܧqMDVCы7 &e9D:GP9`Hɸ6fBϚ6O'?}R /P OE(E=pC^-9NN 1- vĢ"טײU'\5A$F5-G"nӒ)PxToK)\MIJQ1AW{iMH'r>(c_Vgc/cE6ЭsWL&"n $W]S>4h߱Bpv߭GIcN"e[mAUoVpTEYX=78\yueb]Mq<~K#G_Q/~h W6x`^͂ Ը>q My@u^d=:\J*K'5_5R @X.%#n{y؏C8@ r`' ԧsX}` dۧ_<:ছsEuCp˩@JxjLxedVK!?DS/.A ӓpŒlBΒۈ vMF?=7jϵW)7Hil B#\ QG#գK(1txqDU+,}PQf!To\bi2kbH뮅o=-_Y ۲'>:[&cOj7I4-%q1=ϜWӟ?k=a$u !ANn 0LiHH:|8|VW?6y"/&gVXWm4^_a>_ 1ͤ&~˟8>s qL9M^ʇ,~(^,jM4X(L=_Sv3`*1ޯjvtv3_3NI!A5R~ƾٴ aݡQ׹aXd ޫ|3,]e'Fu&Bt(qNc.bR+pgZ(F=vF$g^ba17"!bĂWqn%3ze~\^ sQa37,1 H[<++I#~c's=,$?M's޴ŷ>g̫\A ?yd!{!oUm6]a+  3jPw Z"uT0x]2-б <}*m43e m<5AߒĂ|c 2;6*ͽw ET4kWBaC'YFM-StG]|]D5M.:!R_|Nkڦ+pG8gs10!-`-k_NBmҏX͛XGꪠ [ Xmf\!<ŖO27+Z3Ҳ Kiz` 8x65>FF(p+Sl;iz6!/_u?~}1֢|Q_K)asz5&dY,φ/+rO= \#ͣ\ĺl@!BE)"Fp5P #+hWUw> Ff\ )ZgN`y%͜~C0+zHɅy?^GiYXy cr^8;cQ!((!:&71U&W%Su[F=)/w-yNP7!Yңh :B-Z0!I98=~w 8;*s{e!dV$y6c>vg\Qe=lI@eN(qJȈŁd/bv9ȳ#7dU&+Siw~OD\Ц^'c,n4z,;%QͳeoQ VPOi ID}Alz7v?x3U#FѹM `J͈"YWGB8 p3x.BHfZ,c#٘<.{ ĘQ{+^F_35=sTŧB=dwM E?qiR?{``2n{9s^R[ Ͱ2ץ!mya@MMy}fhBXdZfÊPD˖aQj}~_A"B7b;P2bc2U?%={4< agU7T8K!0.T4uc:mpW I1hݪJkEp} }&yM bQ~β[׶ZS }EgͲ M -HhRzNP#yw) Pф,sgN^7eKI31Tr[C2#D![N!|ףvkRZSa5|U'za9T&qsƯ(|z|E W:^>-Qʱ0av6/ Ty7ӥMA|͢SIϻu"wk5Q'K tT+T_8]l0xIMaimϴܫP%H3}&,esObh&yKFJDfnfƘ.(qhb_n5bu(P\(vtcN¢u AkAUQ;`ԄVOs0dRեq>}aF _K 5]M6 ܮf~ba"9vIn|ekWƽ+ x,j&$suugLݨ 3ý_mYkVZ\`!Yx|UaDb'/ :Կgi|iz`ml]|tpȗ1v]3>~M /*QO3fBZi8c9*5 _VO/n_,:),3J,7tMkR8B\pxCwlϪL cZ5e$*9L x9TsmH<$H5kۧ6)1=0C+` W-9}W1G~9$u"'~]bu. 7(yBV__%*&>cPº2o⃢a>lh^8p,ME[%խ+ECY%+ (' M@aU)҂tJ@c_s+5A cPX-})⚒gPAx]GG [h6E. 5㩄}+j^:t1pMG p넪 ]$ju"i!Aܿdp95W_āO3+dVs:ң9iүr$H=eZ(!F Xj݋#IF2爣KHSYlkg+a/1ƅ3 , HgȻz6WuL2ݫ3^Op {) $ιl{pHB3V䂴:loGrIsrb$?zHN"@N%H8""HԾQNf?PC,@])6L M7\Ɉ~p1 e崝%5r%4.O_,uJ`p+Dy<(a9ŊUxoNJ%>kꐡ2[y0{dۈz#] kLhpܼ)Kߝm9c߰4 L=sv٫1|v z=dWs<VMآH*yCFlo3D^pLx fF4esp)a7˖EZGx9rz{PgV&j$΋*krJb3`"?Ԏjڀ9V^s0߭}bU BA ,eHX@_2I/ۦ*c"s=f BY}3{,Kॳ]rC ^  >[VXk=YB3o)y)mΫPv` _# W_/U1VKP^v)@OysY;3VBzKqć"TĖՊ1⣼a̟2c~C4J[[v2 'MAy =qxٯbr\~(YrڌEM#ͱi "p`6:}'Y6Av/Gq-)NT]ŌF6\l1G sDFiqS ~QEia2!0e37p ū윝ZqIכqhHFPe55ofkoRTyHq" QTm?!\ȓF]϶n3Sy!iأ)2i_=Cݲ&ϼvAI\.-m-h"bsÝ,B yD5 ƥ d2bCMkfM?d4?~A2n 2Pc쥆)U7!Ԡ{ǃEcxВ&\1}w[lb0,<9ik3{iT j`֪/1١8sQ5!mVxDv[fb\(-ٞՂ皂Dī\eBt%#w9@cd`{N*lt:c儏a7=ij/Ĉ`悌OD $ h۰^̦v#*/V0ʥ=Sti6 D}Ý@Bп}@V}cHER%>T"Z:tZ袻_HRX xFCSR-B HB)M\mcۺWp~IN3|ehVNTT8ր' v>ejŎ?$˨*޷!-W"WWsS|T^ͤvwiLJ3ם D8~g7#f/=eDa!1V;My4tZNF@;E9UB3{M:6b9eF 1zSAE: v '`ǩ6U[UqC-(L1u U>Md+ f{Ɗ{[YwNqbLH,r3![\;7&0`DC.[nYN@9ڬ% h?oGoylOx1u> zd, q0 @:@^$GjX5ome)߅=,؟4H^l|֑m'g;8f\HZ!#^aMG/[vSev$'W=GglQNRToCl FZ|SotuuNB\IkPj ϗBdB0b ]po/^"돷R%6}Rr16#iՌS(R?nɝnC#3AG "Ͼ>=2pb` W%ċ}~祈J٩hHgy\GEd膞?E,Ќ8@? j#M+B;˯ z.Év<&0*b4av-dc>|)ܽ I:O&=*} fR-qONB~"Q )%`j;񭁡.Eq@_hDn)*!&ڄjGbUKJf IıL\' /xx]?{S @Ӽ*\J'̩aތ'T${C 7ORY$qT޲~jPALu/߫'w]7E0w~.: er3&=V.9gxSϹ+gvJ*ɉ"T Džgm-3k14\HȄ0߉h<=% +~+>_ _}d eddsZ0VRP&g8zan7_s9̹6"yIwI&Gl.W9dƘ [џg3,0ϧIf(ce{S[#D } W Mzd~Lbt<>Ms0tێbc:Pע~S[z( > @10!Z`P4W%}EujXC: %@(Qƣ)>Xq>߳u%J9Y^RШb0\.^~d߿Ů~#PRޫD4~˞}3=Pa"#i+3%I%r:2˗p k%2Rsh1SPx*ͳ"Gh{sYZByqSൽLG߻@49Ke}TO`x۾m 8]@^)| s@bH^Jjywx:#Ru7jlأ;b)A]~ 1|+ Kzr|CA?-ѸG|üKњWĵTmXp՟n8a$j[G5H̏@!\Jw=7 #f>zwSM)avQʇѮ%fR =ԏxM;]{bp@E#3$DfW|tU<]"4Q.QtX7>b=B RGKOo0-.oU^VZQOčR% McvYBr1ZҘY2p*GTϝ}i糺|ȗɣһ[$i s9zHK_޿Efe!u'b P#}uG (lS'mkQ,|E%~Ow+ܯ$Ob*s}϶Ғiirwh(bw%ta S_!PE*1 VWBh+w9SIz15!.L _]hk:o)4\K1Fd+/%)^Wk\™hArS5$#+f0HzWcT췭Uu\Af`.g*t-Q<>~-/-1/8Z+?>Z(!V)I_] Hi'U ?>, zWMbNl4fu Dc]i{`i˟!H@e-N8 xelmm3P3^hYƈ-kVZo&.@ =0%@,7eK^D,7vD\@yf#F9ؖ^8w-eɇFL8@!,Qt<;uw{N 4k 5i 'g7ߤ8 UJ^#M/ů؜&+a&4g=Jx9z0+G @ItG]P>| 6q 1(72u;J/8IVL8ikϾ“ͮO \ wpyp`ط"#CΛv2(}F@PudKvT"("Aq 5bqNT]F46p޷gbw[}.۴LÒ=bz. 2(<,!)c"7;fH?bh"#j޼9Rq5HBFyyx!n۱uaMY]h,p-+i1X}`Ow[Xº(k_ -t} -]k4e)>y`̦0$fmFk|}~-*#[ >=ٴۦ'S}&DoC6~,6,=uUEѭS(١a#Vx ͦq*(>r[p6#UZVэʣF7e'vB" * j}I p⎒"ٝ0˽s 1^y )4Lx.|;sf۝2pS2[YxԮ.ϪhgRK?F@zO<:`8gFa:[WwI渷I6m0lx\Br'ǣxKݝǠT~><>B6mr>nhWSt߄/i?&dܺn$X|"^՜Wrl, x!>Fn}CX\kZw#ħA^);I,w2Ge\RIyYיWy q Nx{a";&t i9|FuN(T->#IZ]ҩ` .I56:~| OS (5ӧD;Ubg[P/%TuPNOQ%s+VTI!`7;ȐqgrMk4yASM^5yj"Ko,6%LY&lB[8ڜ#A?5KR.u@r筺}ͼ <H%I 6@ X{of|)'YD$P%\8odN:v&ی`_}ڶ3{2 *tCMVy"E#YbN6Us3;-Wam tE1Nm2`Q5Ee:ܪ5^Se0؃(zgѬ:p-1psC-CEtԬ/p-" AN k]m*/G Xj j `F36[V;qcu&$\&DMB^Z6}g> |_ yхrRp4\p5EzlAE^(pq)F+A,f!)˷=)7)\y I\"3d,Ske kfD6$9f(,RvQ,gد]ⱓZy{ ν UNU/J4)XA -rBB=%}7aI^%gbs;uZ&Zߪ@Zr2܂l#Mmh<TF3S$PI*m~c ̸/}u)򸌜/f_V!JFZUa_Y4]fN&UL=o#7t%(f`(xW{^dIo71~'yME(挲vxW>Ҽ Pg.v R^|@f%߃,zT[]*l 5~6?HRHёDXB[I0T(:_׳icVǢ7mY 5~0E$]G/n rj[* ֟.\sX‰OvCu*b:hU"-Sޢ)nLCʂ|Ʌ@ ГU)}{a6N> ɴj썦_۞G|*I$jb@:X7:~6s7SnI\a\ >i~y(+>ްbt1B`F Gyr Yg!ЇvN,{]5eǜoRF"Ⱦq\o] 2xAK<{܊nL_ȇ ' &G#UjO]$a5S(56tڸɰ|/~gdzl0 PI8WjA>v b>q4;rֲ;dqIR1uYrhrF~gL:bŽѹ (^xcU$S%Nb|HuP5zTP4 %^zX{X}@=%_cgnK H$1g=5E)S(}yUVE͹b]iaWD!h`98T./.T1Vpi\Vxpe6\[x<̡kBT+F<咤,U[ @T( hn #U[&쒶[H@b" Fϔ gL=1U<_D+r ]\!J^_%37-AexRΞKfqM:L:(=p/CeLfxJ?A!CSH:V Xk~G>*2;̋{R }ni&y@Hw0V\[ /ֱNO-g*I¯&%8f^#c2MwLVR^fp덾?Qӎj*eרH/z˻Zid\B)I*VIx_׭?"swoEz8\$w$c1oB?-rݜR7}({ٿe:>Epho%}Db#9*tA$)3+w{xYP a+"" _YE=#.~BS-yz n*CW{5Y8"9 sWWi]hd⌾حAM9:L6iBUdU.2ħHV˙ 4,SL!isN!sP\bbZ-=d.KN#!ʙi5:Q#(2_OAwmt#_Ih1hY #7$*gmJ iV^q]~BsxY!@phVrԄl'ۄ\}O,Xs72<=Sܮl lN`\DZ51aO#Vc(A3a}-Z|`Vܹ" vx [ٿ9BuUPĉXǨ0㥍*? Gu*9j6tZK:o.k,%-2NSs!#'%~0M<Ɖ^gv~vLNVnG(ow4="Ɛ&޵`V_je& @ZQ Է:?f߬"`{+AaW55uAJ|:&Ev|WJ#:`G*e9i!<[fjZ~ϸybO!K8%=Y@f dij!( S%rPv["?K^Xp;jYjl#^Oe*#EuRyAî|-taUЌۢ*?l_M3Zjyѷ KvJ38b1Q e ~-we pr1Bc@Urn x(__ۊvDJ,$-^Fq h8 S&F`$p#1O1W>Ӝe䝽!:qO UOAaLq\L^Bh nPNjˬ7SNfXo"@\`*>}Ews7⧃DG)}sF|U/_351-i"aB)~'jixrY3|8 #;n_v˳vW?9)}XLJ^f& ٮ(gF s_f.&Xfq!uXH҂ $> ufקwq%IVcQ,e4 pst||J,R|?꩛j }yKhmHhoVOe.[ |:SyI{~<ײ|F;2.p`8&D(x𛉰z tݖwݝ?uI =b60-{ʹSnSԢZRbXsIP\) ;]n^A @~f06n6PV*QWe #xU dO-j!Q9#f)*gxKBw~ժLsNa!:Y}kp$q"{6MxV􀕀lDL<[UZ 0^9`BA >0_J6(A4fM=$3i#q8ukVR=Ed ޡ̖!65DS1:P6ERO<-4=#.dxeޔj7vٝ`e;!LGzUfـx @Ӵ wdB)tKQ/.1ZB΄L)l$,&h(/fV[-6k=mU=K 6)9|B >76rEZIRMt%Xu?x5aބYK_SbGP޺eG걻^HW6CZGnrAޯ8G`s˒(i$\EFT˼VWMtUO{fͲwxTaa#/|.x%Q5+7Pi?I(V#M<)ˤ9YD i ՌAqwX9lg;y~XBJI|-Й~'6`/k!?z&]q'pl%RM©Z[Ek{ȰDp8AEޖE1>Bv6O0 FG->)V4 S$fpp.x=<,ܫD1V ˁpY-PwyMF-XrKyt{b`Pu:2N% aqHV6GGدo g} }BTf~n^hwA)tzG*TBO_7zsPdY={Ղ$ژ!V<$)L;H8T[]FE%du%DIP4>J%Y/Jr9z=BWK>Z:׮&r"4̪Ad_5T_~ Gj퇞k~IA\ߒ6շSXz]{}m;@rGVTLsCQysV׈,i&7 vTрf?} IlWaB_m&|aR.&(}8# P}sR<;]G{>gmBywQe)ʬM5Ew~1`~ yƷu2sX6 M{{ʞ1%J3x5oPW^BZA'|^'zMŖl*b`fӹ=PL t'̀ nހj~ix\; )K瞺OeZ:h{9Dv9b 0#4tn+np[U* ٴӼwroMK 9@X_wK~6pa5ry+9۴VL'߸alMzc@D!,?ĥHCDEl7Zҹw2`꺃uԺ,i[0\*˷G;lWEL %+BEVJlo_MjpƥnEڱc|8eEX/}XcZK#Ch?H$+1/[N[ JˁpNb X7rTeÁ8Ÿ u@5ȟ[Cy 2#~ƌ7=\YJeB酡ƗҖ\~+yK+]&Rok W; NP{Kw;(xa' q\8%w%Nud0)XN^=.3Y}aͧ VQ H0.y?*`dn.*ֽ5a<>z}bFBيegS窀nS,*D:5yNQ(e's}Z?= Y XBG '@l["e%k)w @잰'xXȽKVtnI?|Wc2\$PjMvYx1lb g4;ZA@),MzEo6pנg_`D[nҽ+xgF #RyMq><ɭ-U!k6b6:o=/\Hחt@-11ELש + 5o1 FRU*T:!q{r ӿЏ hP,hmN@rE.JIJg(` (E((!>RKfIԐs۶>n-6M㿕2\~iړ3l<(!(4V;9sAH7,&LCgKyvAS9tB1CR%iut֛\rۂ҅g,p-EMAKXVT!65ίNJ1,kxl}qD`Bzb~Ez(-.G'RH ړEBڟΰ'?b׏J϶jLb&%rENVVʹT 3|Z2*n.cx*fÑs37hl /1IH>4+jOnj)MpŋT}} 35_`CBDґtxu*kH⚚Nd$*ȜxV|Gn2d ,@UiVerOlEZ\P X3Wv߂g H'sYNqH=\F"${{'NGXH~ibkj vY VdSܢ! Q~<M$ rs+Kmj*9/{ 6JPT#VASz^+ΛH:b<YƲYmL# ŸF')%Swܾڙ4O$յp)lu?9߷/{ h QP9'tƏ4<%̀?^%ʋuwT{Z"Hp,3PzMM*n+Dq2 ˠOnŢfsf?ùH&6m|eHa#$ ~Ry'=AB%Cܜb- JKE 4-UȢ$6P^N]E+ 1aK4 ʝG mM̓'4Z6-ö2K2-m0SُqJ]K 2 N:%cd ΰ‘I@{hcW#r}alۉLkjzߪg-AV l @8d%>:,3wnjX,"[,48`s6A;&Oٗxqhb_󏹐3M8" 1Ǯ&0) RgGDx& sg* -'m7fR9'o+Ln =}3# !:F \,jAy4f[R_&QQw!rY OηvJ`hQ3Q=Bm쥂?férnj܋Ŧqxl4F]բO~!66ZJrȠOYizSo"kܱOzt/cFg(p! Tr5TR|(Ad0\ ɦ[ed*C35%S흛B#Ѥ-̥6@ ֭V֏~z##;4QD+^nS)%uQg ֆP<"nט5?z9)OhM}IIHuL~@ sh͝7-U4_=8_Z!HHYe{zd㪩ߗoQ1)HG㺣(]7Hſ=ʄj'O Y/Y/]_Uͦ?UՃ/i>c{uz߻5q?Lm&WE6"z$PbTXK[\V!,oxq/qg҇^wW?fYxf GA:i@BafJX : `lf"i/З/T"Fgq8\3TԬ]CJ aJz*D-{a/>.V ɼJsSmو[}(l_:1 IJ 1ZrX(Pda266KXݒgp0!d|3Wl%EYe6`xJm7-߹ ە83K̆R}Q3ԯ6hB#R:`,Ea]ˢ˜רL1C >|tAߜ JYKce,Fj/o НM i}zϳ -aZ:c$+{P5&mWƚV0h/CfJk#6Jn64xm0e#ViiMXKy=Ӕ ȁr7s&\ʕ!I591X(*APCdd<{{}/fP>MCo]N^|hk+SfxӍ'duӔ(t3P@a &`Ă Brd*ɰBUT^.rTn;mR ƩpIJw΄|k*"kq-<0{s =?Lu3~v/LݷH=݂oc}dʎL ^XQ7~7-9ò8A 6LࣣXxN·Cp,y&Jp>Y++LژJ8& WAٹJAތ!:6yl2g͆;ϯu{=ܰW"&pŠoRL1]!ry3PCTgr(h^b0^?F0K (L1mrՇ$0LcAWJ>Sĩ~4#F1h ;'~Z 3hqxg9޾}k f02WhD"&I)Emݎ%!)ރZyxL^\b7{J+KZ} 'H1Mh][I$@%N&;f -24&LuX !7=ZF|\?9S^ʙT6z՘qͲ \w8 Y_I=s*k#<,A|,"w$mbH؛s\َs1q6ؖҌ F2h)n-U9`CK,)* \%Q%+7dAguũxoFvOW?qDź!&0=ϿPc¦|QܵhkޱC;6iS\~()ӏfJ^^qIޥ 1"4Lţ D~k ;Pƾ{'ǒOw: W6,d0 6_; #70xR վW$hǓ l} N&-DM'D6D8$Ftta3-2o-?Օwc{ܽ|+qj*ҙWK˃1s$;\,w,-g?/'cukit堇e`peyPcY4imGx*-d6-|\$6Cr4r3j#di:{}5l1U8yEJu]_-gYIt(:7@K*`-a!<VNlu9ծӦ)wEE`ǹKI9RCQ`#̔ w'%:9 TO! QrUohF, z-RP/_AV{};KM Zg"O=9šs|xd цCa-Cb*]nHsI*C ]$.8q mU:/;Եm$)yehS @ztm |g Tϣu2:i Bg-_ zRnh3NЀj+O-@:9|8wYJSNK%? {9{h\ϖ`UcgV¹a=22¤S>5jtB?_Gi}t; c)ؓcTS V5ߎ'ARa^l~ˏ iBדjױ&I*NK>j4H Ŭ A:WI9Lk{lN?HմKQzұ"66U,S(@%$9s+ݺ^*+x&1s7MV3?k det}I5H!h:LV[1ņ;s:?*luIŒL *4RHHt/s("BỶ\Y*\OyǘZU@"2M0}iMtX=#$C4i)ȘKߘ MQYq'xwz,R&cnGXtφBv~8(i^U.4V%0 BIY~qOkFmM3{(9|| CzQp{D dX$dKw/n:G8t|Q /+Y1?D||xCw<@+Zh+yi@ _bTbe>xGUD@a<#BPu1֫DgQMNc愜L0AJ,%iNAmRɭgRFpL$(YD_ӔE|vBiK }c])/ZPOΘK|H]$)J hcf5:Z~Ee<Y7 kjw`GL3I0Teg6+lYr{eH/3hUeyW6ekz{(Pz86 ;Et" ߃op`!4F=%(81y72eLtV\ F֗@V|ckQ_g"_;WyɟuU!1yC\+:O&{W5[0|kC Y0iM*\zLyJV*rfbr7~ p.lh95ۇ+,U2oʗAlH/4RD˖G~EW@gj6`z{-:At[,q!p;0oH&X,=C#䞄 6z&ߦb!~ls{s%&1Vs݊xJCCk).bQ' 1;aOۋ7'D'}0ᑰ_':\ܳIKL,u:y4Gtp)pnh@P0x_86bߘ;P᝽P2嘫6z7rE% Oh`DZvM@h03a$hS52yGG5MOasBV9E1xs[AwϞ/Ga Jfl zͮxƏLO: w@iI*xƟ=/)`l/ }۾-T$<<TbK# DV|rf~[_bHK;ݿLrf!zԙj_{)$կ>gU";ȻP(];4A$+[5cNzyU]hxNmO v$ 6{vw(KMl@)E.%35.AwQQ8<iXLz2;e蟗([{Ț&b!ku+la'kDOv>8eL$@d,$'gM.O hL\- e̸^Nd)f#F`֚0߇]>g.!RL0L^j Swؿ>@L] b]ny9kf[ Փ<>ޢq4ՇݍתCM]^]5Id͠lS N6O}b,'U. b#BhVkV,P@Jmk UfmPՁxY`^oxdD, q~x:S)H~.9Aw%0hqJ $ MPNx6AoUH=RG[||`U/Hj2v{رW|133c讍naƻ͇@%o>^=<`/A&lOV.2DA<_&2RsBki{+ξ~dž&0Vzɬ-LjTa9Є%?1kg(hu9OF"}ݚ8:?_Jcթ?t_4Zf!Ʌ%yXy `; ɋ:z@I y>~7cCC^nPCiji*!vSsޒdɆ_8k4uR xd[C2:~α[] JSLnhqh aWG*' İ+8I; ?ck/6CQQkwD$ocjˆ$Y6*F3]&I0zD̽]\vE/G$4fY!,z/9ozzdJѬk-艮R $ )u$W6,?8k;Ku1LN\҆׶㝜^ wQSڀQ= 5EsoiƷx,$qU2̬ѱhH}o%Nt-5PmQx$%I5ExB/QMG7*={e0_ b5 p ,xNjSS5} jG;$ӟ0b0qIiH*6Rid?RnY'tX`'qR̤Y;H *ފ2!QYX2!:^eRqt_+%܊?z}_L,Ç !V^^ ~D_.|fqL2}14}Ehg2rL^opfcP729(;gj2p /tOD?&?+}Ӷv2"ӢuCڌێ4:}Fk휤EQͱɤ 8.rL5&+FKtZDw(0 !%qXf(JGPv)eG!=}Q 6L!ld#s։Bfհо㬨Ձы'q;*3ۯBːrώJ:vv0xsCeX05:[n]3)6͊vdT %>T_M6S$KTz CGaF%&_Eg$ȲTדa,F|lQ dOp-SeP;w!"d rC7S!L8sqQ0$ @4t6 #wU.FOOc9%&QG+Up*(m60fI+, @Yŷ ")HٛNtR^k#)1+`RxiÇ\# aelΒLՎFڮ$G y5,Zt[0%޼ 6`9n:g8bɥ{ %+ aG?p_4y5mvZ>H o}ԺՀqOaC))ܱz\Gɶe 2ńqxFvgjmO ZE *[LJ;-DGVoh$$sL-%zL;ڜYbmK-6l6 b[l~с]*/%j(rlY2Ѱ:A>rKП}:pml2fԖ/+f1 F~[,.>nd L.L8SxtoWxSB,& eЁYLtZF(W9 }ݭӞFAەʱGYDC%=> ]t.+VQS|}]^Q MZPXqȂ"xܰ6J+xjw"<ؿ5skhG!w;W26{{>{d{'1~aivߘ]虾.siĢ7m^Xl_yj$kma_44 7'jMI'"Q-Tz+ JCV- |Nu|>2#DR:sݻL&$PŸEǨj ~_sJ >^ ҏ w=JY5kqa \M?yfk W$ |4ifY?P8ΰZGwiQ9"q=XjF!KfsS9IM)X'{rٻzCè ;BV'X~GritOv 'BuQB[prN4)eaDsb|Ќ=]M9)d_YȇA,`sӰ̴<=MDi!|a~alpV$bXtOڥmֱͬBzV.}}4ժZlciqKgI ĝ;?,is1ڃ8^DMe>D7t[c%R\D~tw }Z% |:KܷI=&C̸) kޖtV)u𩅛t wCuJ0!_Mf I3@ḷ{sOԫ:<;s-`yB$V"uwb{(<*OӔ=/!+x&m*IYϷ.i+;7G]9MxB8h+ԓ-Ýg)LUQ{"4Ԁ1tgf;_H.GXݐg[&Qzb1aݔHmE 4;']JQAXC4aڍ+MF`PڷPǓI)< 4vb[@[s=VRdžy Ca(5aT77l  z'^~M%u9L(3!uǾNm)ϢsGalIVOXosvb4Vx2ɇjPT'ЊԀQ^ T).ॳpuY, 5`Q{Sȅ/[ɢbwGsI6(v)3UN$׉A`B  (+X%SCyx#5稧n ʠQ~ <$P8#ӄM@9Q%f~`g@L\xQ1q0|J2^c,j'!ۼƁ,{i I+Xg/wbkd[Sv[O]UFׂP'Fzus￱1$3*%1Mw8&ԡ,n'uI^Ry͵tUeo-3ibBPekx%Ah`/ʼncKmNZJ.ҚIXЮEDmK>IE' .Tn',2à8C1~l拓Pl ꧆4Q B4-r3-d#_R|s\VsԚW FQ H¹J'0)+H ϗЀ[8k@.˟C^-ce $'.9dnUA5PKiqQjFrU7Gs!ˣC1΀XMe%-584hWl W2 ’MHYv)pS<85{+ | 9^QZd$n#9-0_x+jԤn%oՓ>-E Dϟ)/"(1,pA]OK.yu* {B[[=]e.wMr#ibJ/c`C$%먃mDTtQ[H_c82_ !#{\?1<~eV}C+)y{Mfjv jzYCD*:3)}&+7k$@A]+U֞fUxOa˔E{]V2Al$~m(]n>Y|DH˄/૯>fF>#zRzjӳ|'NM/`D]!NwMQz|:2.u]W"/:&1%Ėdok{]u_AK5n%&3"%U[|޹a]}&WeHH?`3΂V$lqA+&P-E4@XJqGeCJ<H ,0p>wЦbd*`E]@n:;;w+-+] Dv4EN&#g{kA3!*XW oLexca>SWLۛi'۝AH!`q42F ait|:2N!ŽXhR1=o~_-F?%P9LOSk(f?6W[ZGڵLF ZVq ?&Zk;T(lO4yrLER)6?O~/(*,P)c!{H-t*HPz-[}#ظFNZ259 Ü" -)v ʕfaϟE  `Cc<}YWtx3MSOӠDyMtsimzðbJ"`f(#`C$ l{ゝnKw1u]q;ĻM VDQe?5"h3YSM&lk#?~N\0kjzKZ0K}pe_.Ds"L,&+o<Č3yD^ðAmaxnX=`%uٴ:f z jň,/:=QbC/£uikBlUaNx^Qų`ӥy?=OO-otr8@~HfjbXvu<7q%,ݣI1e/ЧHB;6(&zkdzz 0ol \i*@+u-ޮsͅęU+'Nc_ՎGNp`7|pXƧ_V>?- OȽLp67pB.'\'Jh/ Su`qexO緎\O(MPlfGzïhyc1EMyE|Da<*JL, s)i-j.D;}}lkg˔S fDoذ Is>c$AdC᫔Y(>𙿓]ѕ_@/병'qϚ-αv)׼ǜn-)[]+cNM|{kxbr%owv:UN`9L !83D8 w =WUp{f:y2J RA"1$XU&B":3mf+: .|Fƀ:ɢ4wB8ُw?+mRt\h>l`](E*,puʯL\yBq~2ܓm伵?\߂1FӁ?wV׶_*Em/jͭ]5Bҫޒ{-`@Sأ+ "gHs~C~(c)vN!S?5Jإak9N*\r+vI큠xRY7F/*g|X6i 0 GZI4jrn7r=J¦Y3q=Ē4W^wR DN-+nHO uGH#Sj%@sk5Tkhn¤r> w:zaPpvf7ސ9{Ԙt;R>J) +o5@_1_]6멥^lU?gۦਚ  m0OӏY,|V쓰~k˺5<̣uo&yߗƋ!2$[ aeKjgnL<ٷq/ 戍gh;z-mv -d 0P<6uy]ozVԸ s/*.ܟբy:^\E6OE&|*XA(f_M&F^د9oe=7-@C"RC|ÙuY t*ȩe}\θpeI_Bi{ӱgX@w4o9rQ \$FąpK:A.8 ^V VyjZϵTo Vx?=YEQD) U+|"(!5D0M8=K4H;"lkY LDջN2UhE_&2ϤLP 3)XxB 9+Dža-kݐn/RD2[ZяY ΐ+ʂfo7ZZ&%ny jtE9e*9uڳɁ10> 8$H#Q퓷GfIh1qܿpPW87 Э!lTI0[KD2}߾2͂9\OqJE=>.8tUnUʗųK.rFs-y~^ӳ/_BA=V@ &3sV ^`iY.vey^q :玒|a8!SE.-~wW)z: tvBa/B<%f܌y;esX =!>|>Jn,)󊀍Sl~8a7Ra/ Y@c-O)S؇6 ځ0APz|Z]]ds1` :PRxob9_"TP֒\I,SswI 52MI` x"9ϿZl^'&lo=CC.;7;}hۊ9β5ç=qjJ=)ρ<[M zfB}r. 32۵% R b/ݍ PdŎMݘ{;?il]A?¤ŞmBWA j8\[qfSelhρY{ 92=~q>)^dS톄-w =[.[1oL[D4Tg3ᶂ60N$p'JYҎ>vX8|Y+Z,ս ec r.mkϴYl8n1af c"Ń fu$"7j2eHBfOj?1k|Α{vY z hAU9:N:̥KJY$X580Ӥ71ӥm0q[N4]I{B u2ײ*==A;db֜s2IM:g~BwEpڶB|cOyvo3/{&4 Q٬ewwdjIYT81LA &k uΦ&HZvu_M E% 0vY5+Dכ@A;[\|` !ֹ58x q2ՕM@ 96F H!Pؠ~d+6ʍ^0 ,ۻ #Q-Uwp!%K\w); 45" =oǮduI 9DA+,69>4G:YI `+N+Cߎlkfp%? f#C`GIm ڈ{҃6dX#6n|N%M6,٢'J6Sx-a- B8Yz]ЈwYVJ8N ~UIL,;O&Y|M=H{s~G,VykO1מˤvrX bT <)A,T8:)b̥g卼>Ld/muDgQ{o"EE|S6x6*fK岦F]8bIsrenwE;+nj lC^YP\gz@~&yۡnc܄{r@+yӮ8vLVPzsN{j؆Mį2ժl1 % c\;+NEexGa AK1JҦp׸/éi3ٹօ )ZuXFħ/oَ.܂"숾r}Lc-_DŽJ/ϝxHh+_/df˨G/yk6Ƈ<QVi*ψ={H#y8iOe8ك9UqGSL)gz?&vK@x+Y F~z&֎iT >uq&XF2xp0њlrX j<,OTP_3pA?䑰h- hBx0u??B TpnB" M|j(ܤjB|O !z(Eo|HZn4QyQ[ rXuD0jBfB B{zL cS~xAJ2WS?MH#C]i9^S %,j1v]r!$SXT.jgAszL{}4; cXv?.2!eg4ib813~Tme%B.B{'jTY}WNF]c0Ka)2'^4BQUE01؄8Lǎ{6qo`cF$BZo!<]Wy^%J }x u)~}k?߰`vXRu Q8+` RedzP:hxE*6{ci+όzRCsnxPIGϩjƒf*$[a#}, OѳD37^m19Y6% 1TCjt.8kHY_NS_vsP>󧴔Q2  J{CwG:9O) "mǗ["gU<#Rw.5S N=z ZdҦcRR VP|XYAl V`C'9To~R Bmƽq0.:R^PXN!Mf|@NY[T[d'1Wd֤]p& !aOM:I(dk/u먳o56m;yǒ<^#2OiU2\e4&J*Gc@_Z7ze#wL1w-xU9ee(DR]6P0N8 t,ov&E& zf ~T׍:z(: dʺvJcTxwK}>/[1I s pӔ+2b|LWK|f*ᶺ?ԀadP )|(ĒA]0j*OzqzH%,H7D,z/4T P7ni2w64d['kǮ6nG6~lv6>ې9FP>~D2QS.9?ңu HE1ACgob:|E@[%Xd]':GKcuc/a\"x(|y5׾[Xy*N?s (Sk:^*dBX(պn pC >hXD_Pj[ތ1IM.ERǷm=L*~2X8RǓN2Su1p/N'Gw#jz;*2Ѝ\?x8~QDa-~TʹT =JGhd NV尺K'bq(vw> C 2(@UyJl;LG]kPu/C;Mpr7oRhBE:VY 8N#tn[T2IG3<3.C&3NaWLC9Np-N0#x; cWmVgKwm #z*R^хy-I{eBKfXE㩞[@MU)OW 'h9)v5 Nog6<̵0񀫶9=dYtjRGZi*<21+.ڒkp++~+f?!>O>CxɿjFݐV#@fM#%㉠tP52u=j soV*qR٬i,UfXNlna4}0,ۜJ$&xG`&s:CZe(.`߀ry0dO9:"|/`[O 1/~R;W*&[$sr&~oLbu_ci@8U#dX>ΖeV5 < -0R˔:qJKTu٥*6:w/<7;o׺mTL+"/aJ9q>}YtM8 }CvDn"N ρh45 XO2Wv`wcl>wp< Դ z|Րfk{#6 N&\_-JP> a(hi>݊JYnXa`ЀhM_qW;d⧃Vӻ\x쩠YXzP%j]4Ik /IyK/k S<B_LRFycL%=/\ "f^b6RлDoeh[i@pw*bjd`+z_р>٘L|vaYĨߌ V_CĘF r2ETNE ƶku_ / !ّ `>jrox Q<܃]ćXrƒ2W2#KAd]ڞID\mwoKR 畑 Q^ d@ 3ZobM]]Ew[;fjT]_ܣ%bJ/Av+*G~tTR'6Ph QBEϓ9w[MA&%9nN:RLi(3i23_T顀ݜ}( oCD`ie$GLDQ\L4.Y{O_Z>/7J̲ q4@8@6Rtx=ika.C"U.(C[oQ-k;EtȼGG1FјM%s(0-=0$/mț9DOS7ɵ`AfF#2/ cU.oyD|OkCSuteNNDD K2kH֟qjƝ% a*li9p*wG ڿ[b??+1]Iâ Uae휺VoKZ;XXф4rZRX^SN?q346"vs:AztyMfUh9ˤCH5-1SEu3D y|I]$GwM'CUt.*u-L6}:_\\ӳ0YW:Iu{*CKL );-DzI9nu#uٛ sTaimإKR5ퟕ6l2 hlВ;J睄\2Iz)eCЯez>J~?Ҟ$s JBa<2DMu(&'HFQP+g+  {`VR2ev_#D$Ц.?BmU f*{!o=tl` >mJ*pKk",O0pfBda=|Z?soTp{wWD(XgTkle.m_f? )/E z_5rm 'LVE,M) bUM"9ҰA`.bi̵]vzFO0Lb.no [74<8b($k r(:qYSZ=YuFSЗ4`UzXyFݦB ]jFև >Imu:ǗØt_T1GSx٧I>3>/\s] ڮ[PWwќdVа}0WݠO!,ͬh\8QH2K z7钑cƦ橆hժZg ذ 2eAKm"PYþ߆dQ*˶vUma'C\3]uCV 6evgL#m߬jx 'SO*|8gx3{dXRW=;/i=IK b[@þ./,$Th@ G6DjF`x6ۼQ` OB/>_1{RKhcH-9 lQ\(08֍+p[Rgޣk@X'=X!7zAOD`g0W69YT/$5 R*Rߙ\c5E-"} :텩G SbԲS3-xd ѳ? jo,{Vbdȍk-k4HK4rj$'|7~+BlbL%!址oh "GvgSC35b(Xos2@ݙd5A AN]-[rVAX>fP1 ?}/I5y^7EMW UN+\ypŎ*l[~IJTSX- mOi !oG5/Z@[F1g8 gh t5ΦPwS:/4jemG-nM\|!NGpdq%U^o\rUS#:Q<#f~z!K鋽0(9;8O7$OtHP8x*r!%O@C:'}P6!ͦCeLWU 91⦃ɢTA^G#`5HzI7EF{~|Z3%͜5+dF}Wp]&۵ Ƙkfpl$=J#Snm%nPLDj[ xzO n `e߆JDjVHOyﭥ\<Ch֚Iҁ1 G}Z[Fªd"}1Z*~_I/Q1] $!!1n5!w-ᖣX Ohg(fX07ޕH&th= fz+q}ȑ6˨˱X]S=e[ +ݐѽ>F4J, Cc3vh[-tI,pѹ,TG .6(eЁU RYNF]/FcTxRI͎]˞TLMiwNYYdZ]c/qEto6]"6Opx.H&lzqPET5,W!iS^O{jk6 :|#hKZKT;t.>pFR[ 6X4)Z(敏垖%\ }H w"P~mƩ}ߤɃ.M(4C&*mf㐺AM7UQ9 ҼyODk~:F8 /l߱iVfoXFBͤTjqE~pxJ ˿i@ @rKUO eef E\Z\x $&:#iX#!e#x0CEj@qQL)-'W^?ⷭB(:^앐]/gRcuơV)D.4'5iH9{ >dbeW]eYrG,(z۫v6.qn!7q:h@3DJ Anx迨r$~FݷFyS6zfFO1W0_kJygYŊ`u!M)#D#l d*AX0p,URȜ|VCva9*G"qwR'7W7hT:VLEcuY$1FhEÖ|%](G G1ѺiE;cL{'@wRc@^4{؟Y|teLX\:9D'Qkl89Ľs!ŒXp)hd)!@6ۂkJ:aԞ ;"T@2ݮt Od êМ? 2gߗpJ{F{̒BU՛cgFTϼ2 zds R]OΠHp >a>^[xªD'Lu 喑R3dmd!X!NɔުNx5:C׵BL?gebcUƾ9sFæ>$bx0k ,#o[A! )F *גǸQ.[Q+}eD鏹UvݘZel wlDǠS2ㄟ@8g4jŲT}yQ Cʌrhw_)ucŐMQڰCJ)ڶ372vZww"њ%4۲Lb ٱsOs;6mV֯#K)1{de"u+R2 5D\b1N8c֤ʻ[z{u_Ee˜(FrF!1u4fbcCkbTbzxPB{yY' -aO/L7NI[ Mٻ]k\ Mg ")Y $*(hJܽ9Ď=)v;.hGa#/<|&2oIU2k9wkH=@P FUQΊ&eD zs1h/ $9 LH[ͩQIhO2^;;[5%!_ȆATYh^%ۉ0/ӰC]@[PiFjb>;iӲ;کѯ^牡rqB-QG rRO*3jܮ-"^zځk_s`RWq?7epY97M! Ί-<<ҚZOŽ #OZ*gzE0 ] +ZLo߬77#7dB텏r@둒'4߂(e!8MЕ5%eÑ̳h)1ş "\8fA^x*?*}<+NCErI\MQ ~۔7?X=)>w+˷UԞ3͍0z5a+pIYʸo-jcmflK_,C1M9es?)ӹ5Ѹ 8X;'%vz3#q^ (*E9R~\f1$+4wƽ ^G#r-6F0*6ۘwY Ru* 2ћR`znc;aI&^#u徣.lN V3Mƣl@;hW*F.6sJnH#x!HKԞD;޴xڳDVzlU3!g3'vFrPh|@٥jV􉀙cLF>oPGk*?ǀ$R`\ JCˬ=qA(zf c@\"sJG߈A[<?:u1ͷuذrgR[|bb;InP̵ 7xfe,h7"x o{ >i ,CZ^pW<̼q,p ܜ'/Ss5 /<%=,uW݃-uxU-'ڭ\<aag}-TiI??&~ BaR/wY $h@߁̬`=\E 5 ˔W*V16~ o.㈟8%j=ӗw?wEo_4KVdy,d Ώw8e[_3frdqf8ky+)%y\Ct@dQ7Xr΃Z:<{['(:rMjx Beֶqi:u]7+ErDGӑSmsԪ.~` 2XZ>X'0/۟׻faFH[v|l*hsWOfJnϚ(I֟Mp4j,{*(,zB#>h]({^\櫜^u7 oy]rEUy1Bh0_K|bE_h<&H{ bYU^5QcY9/<@v Пy6rhɏKH2'hww]ž'x4[<~2#[EeRLR9 CCb1d8@=VGu)_zu߱P+y%@_E^={#Q#3c2y1#zQϷwFfpkV'Q  4nncÔS0P"vk5}l2Dy .2rX'XTDZ+'@`V`}1\G&{BA̞A"]Ho1 6[N?Bz9ҟ|4/W}Ə.2A ; W ZWȇ]a33ȱՔ\٦6 "+Ӭx,%"9DFQm ǥXw=/bT{qy91%TqܐZ#1+Ӫ`ڱޣD2FeAX ;T`3svt5of`xg̔/E9qd;u\t[&R`˰9XXƇr(ݼj30UODQ,ۧXU5vZfR8k]f ] V-p_vQzZ& [yW92W@2UeLT <6^""p'5oo[c;wu۲;z)Ԯ͘gˍUiS6au)BG=K1: &@u drvuDYѸC΋@kF73銰+<85wB(4FNsybmKkT!Koni9k4lBͪh*'^)K0ri'6hZoaw[G^Lj*] _Pa%\S-DO^,7چ9vZ&ΉPrm٥= 8Z`}$\*/Յ]Am([ Ɓ*][?0dA׸U_BPlՠdGz (9Y  xk꺲M88]"],#4YQGw F7ò3ʴ.SW4˹fJ"`W|ԂA4YY 0jTZy4= wӞ*uvg$%$M* zR&|` 2 Th\7W/^0rB$kTAu%KDMFj ɚx:t+pJ q~>Kq%ZV=՗Q%2,&qD1~ P׹(7r]S~Uy|ĵw}lly7l1ͫ/(~e`QʝmQc'Qe}E?Иti?e+@=7sO6xBDM.fiw0"¯x&T.݅M󨩔Es CPR}l`C /*q,l.Yu5Q6`ZS*ҥ˞&~`#!z[Y=BI 4/gV,z&JU‰/Qu9 &+nĎ©,cz]M4` +OM<4Tp6ItCJw̄:?'N8tCrY$cST+Gj4P9vyyj.4$JQv-'W"0,=URdPFd( slSYБ1ҭ`l _$cWg9]= 318RUlm<14Q+:6]Ibou`}g _1Yۜm*˅;2˸B}~ZEr(Bi!PD ȣ[wFrLkW5Ѻkܒs+C\gQM6ĖrID$v tԈf@+8*T(5,Q:u#iUQFXpTX'pJ|!LU_ =fRRy Př!bvu6|3),`Cwn57#LvrP(<9HP, @-RϤhn"d1dlع9 $;$sQԆ d1eNWVǕ -n N~8 43zy›?&bjatlAe\Mhjy$B^7aa<"1]va9`/C!uH|wj҅p N&E׶#B4.:ߴgӥLd2t3C2} fnۭ)S Oh#3+ ՊqtQL"|%πCp<4~ܴVfƁ )š64 IyKkq˓4}؏ r?cBW snFC D{`cOV x՞;z[ݏM t,gPJiZ[qp_xhJ\9kG\S-~-<|ڼp=]쌅^@ihuV N[ `'**9|xѧ[?QT.27J4? d*s@ڈWzI5<5ox7 ڛ fJ4euqY.ah(6a/zOp70?t0^W*N(j"fgyרCʥ hECwNsputW%kxWro'opsǾ`;_~]S6jpĔP6qÄFԘ=?am3|ؿcAXn4sWɀVQ@ԟ3EE|KDg M\JMxB덕ʙfR&S>~K3-'~?%gQ)镦{ņ@&3Ku)3 Pu9hTk^<(%2=r(RLXh>\HG!!%`77{M:Gc+c evBk{\ZJ쟼[Tx>ķS+9q*kJt9G< ҧuO_qLsP# 8vñ;Fp0Xҗo-#}EF} V= EPN*M(Y_-sǞ^d 2H5~9?/8P gZT?srRm &<`uBw#ZLzn 8&Uo\˂+U {y t<9?~۟NPzL-/ޔn.rИ=EߓN9 66TEw~XX""_~egOVRiFA$F#$]!(}Pd :dLŔj: Gԓ۵9%*V'̑aHoglxjXR`ǖ.u01 담ϙUrHau_ߒ3zJ駓{^fL(OU_@0B_VWE7?l; X1Pyel73 ,-NCϓ mɈ"p4r9Ʉ{Q8}d'_Qoj틻Y͛! DK¡,A`3k=4"]E;`-F#ʰ\@-=e2EE`H Hp`{OV9)qRGUmCi1U-vkG{q$'z!nn't)/*G,Z!3 gnά ՞a[8sW?P"̇7ŲGxK\D߰gqWq WjgեvOArfЈq'$S"p/  .A^ [*y%qz0uMֺUk a9zσoL!vhTf4q"#; oH?`#*"EPQ?|3|\㺐E b|"ߴ۸p8 PW,rV#ϿW`8!_qcm;Ql~N5$64(/EJ~fEYe -zG@PYnzgQ)|ԽV w멦hP~0<7A>zv6Oؗ-Ҩê>|JpptMcS(3$YI?4{2>/f\5`,pPP' 'JxX xO]A&^cRYJ12ّYb2tvuz:Yj/wfA ɳ({ .*{])xK2 {ٖ_DFDMe|L3S28VZd|8e=9bTJ,!moM"P`'Fɘn007mH2Kڷg:#tN!sQג^Z׬=>,\oU+I})XEX6b*ە%+dNJD˯&-Pg9tܐ~G.q&fH ^H' _J/MM@wFmErٵlM_Az-iW& mP.՛:yHCmȰaWO4p;wjsڰzb߆Q;l>(QMapکe |ۓaE-T6ɵeC:0 8uHB_5*, $W@l;L)N¢igxXo A*n`^#a BovlibҌ yqpiq6 P.TDLuB~5|ie-MW[>XcEVMB/%9X۱KQܱA6J$"rGyI:4y_XC "q\1FF %jZMCJFU;88 zJ>:͐T=vd=ODPLQixF8 `}`-suо d#M~Y^@ψ'?bq V͟0s*m!ʫVBX}{v~5ʕ9 - Ni3{JjfaS ߐsc Bo52juh~4vF@0㝳kFw6VZqyx σubمoFM%߻Upgx m }T9lmQ)W2Osq瀱#oQ=&`o ~"QdHSK74_#ۛ~#.0<7L8L49bZŃ@_\:5Q9T5m-s(JđQ41/;FwxRp!+)۱VDcrLZ:p>>C|,tl UEfy8fy0_ME0;TEU?~l9fR8; az8 ynKMvgU0xNdњatuz)6C$M{&~L+ݎ,uj"]Ag{ "i u>DhE;7aN-g#D7yۚ+eE;@Ԇn5<؂zJ}@ -uH՜d eh =Sc.~8t\*Rf¦2GRq 5!;o$>!QcanGގ,:xHtQ6l+Q#:*XcD>AYu>G x F yPK=8!>[ m?.kiPy4XYv<Jo-E[P\{*3z:]VE9m 0(C9r4lrHC`yqb troYM1{!X(4Kjp/XRf0CrЏ,FY<Ӑe%}VR:|S'BIe0hc=?Tfd!PkÆ1BgshIĤ\[[)˥ F€Jq,7"RÇHT/[⭯ jCg8*7Y`%܏<\PL`IȘUyM%`³~":'W,9Z_Pj`^8,푧cRg&IJTLyG Sfjjad}Km_![4]lkB.rbI } dYy+Eg=Vzm7#M l٨P;v!̉rgFF[RY'-/'AbH`EL'd$zOpp-BYϪ 8Bl0ƾ<*=jkxrW 7eXW~|Uat؆ȔKG@'pZLyt +@x\ȇPxtrD4CDc+͏m>=/>|3ϭI^$hv?쬐zX Pu $Ym/{-OK 9)cy3U5>ϽZ!@ZJ 6A@䴊(d+B緎 @L 0nh>f? gQ٭=E`*%tuy1(sX edgP]luhHNىuR|Ϸx*ZT34y30b) cbΒ8Ka#k5N>b^,!AފNH4^* ,rSIGXJ|JXth2V^%} CYPsH86.,_Nli{Mur?;~q-RYJPiF^]m'#=5RZBReq  HR0L:Ag1kv0^0sBL3d,+6 -cr2 6r߃[o'SciwaZ0#Q^{"zMH|+Q;qSzܛzH %M7vLSzSIF'AqdfҮ&߈ыn؜gGϰ?9Zӝro{wrD"12EC:DKQ>JD4MX:c @%0eӃV$pоY7Q f&@N p2 J1~SnDK5\c=CnVkОF9㢷uXcm|>{K*R %9#cQ{M.+Rk;9z*,41Oؑ2- ?5'СD̔K | =ʺIJ{Ql[y^:7U"6'|VP&<>:gF{eL+Z.kĝiߐcn\vݓ]1vQwrP@/O>)OyTZNFs%wƗIljJ?Ew 9)tMM}א/0 )@x8! c5eνx*|cW6G2q'Q8hNmk`RݷJMTQݻ#7* @R'|o.6""ZptD: ڛS;iJLI K\Ҿ0384>%=9\XTXe% #ى> xݔ߄,l29QyEuD7 :,PU&[g:4]k~f yrM,Oy\64pjNNLoKL,NH&0ze>㛱ldtjf0vVPނ9۲V7k!g)E<#Q0IA dܳ"D}Ck!4)g^3Wժ$o73J+4/5(BD}U뻥gOښt*Œ(Kg߃|8~yLUAD_,}m2_ժ&4&u3.np0]zNH}ʃx r ?Fv/39(ܮN"|#eAhRtE@MOͧPg UU>Y4c7UTz ƽ}g8^:rƱ ^Ԙ爃6( 9,a^ T_F#5fikOl眂 JiuҞ/x*3=|K =y\aMR̩E7;YvhYv-0[8ixwuЉ;,^F,Q<f^+=̽vYtOϕ9aP9Ey?HʎKd8= Sa* 0+eG栁n3'ZcI B!ޑї ֢vQHi$H~4 AMJXwPGX` }_|)| d%kK_`{{IaT\ROP G<$;6oEGk@rM pU])E8:0'}zp9jѶ@ccHȘCo :u!\ʾy!$tZ|B >V%z۶=հD-߈ ̸L Hm  HO*Wo,c@`bK~m*LWOH{z W{{4/^MJ$`OVi亸Η,)j/76KJTr(ZyDkPn%Z{n勹  Y^v|嚂,zremt}[b; ! =,heQ\N+벬vKt3G=dhF:f&+MaDhk)t6CU@w=Aa{ZoO)OZ-ZOν< elIUfMY e[agΔjHI!U*HxjgG醏fJV0lM%pq֕l\V5?) *-}C߷O[bnj/ot^Ɂ`&S^{? %cb KkpP[JS/ :+?iy-)2뵊V@&4غٲ8hc`$=zH P/vB{5O<$IϊM`0c)LyEJMpb) }C\d`$ -\!>nr7LAhg-"ON/q%~^K( Տ՚ 2bۛgp^ϳ ȴy{(㇅W7ޡW6#? 1&pXnM/GjФhA#oK{ЪpX2< O -HJdeiG/~-%!S1P.7#y}vJqULKU^|qM &=yG"&vPWô+&Kꠤ,*  VVSzQmY} ؕ7׽0(vO,r k{c\I#g,^_ 9JcPqxQv!rZk5V<8|"d7MWX"9M^ޫV#C\E';7!{|HRD8: 01I* &%0Jvj@ QP1=!NsPo N6x'X5= |@W^2pɌwZ>HK|5/Hw~:x|ѷȐVZ ^mt{psr0ߜ T:cm(1L7A(~F>Hjt"ǙPH\{ɍcl`RP8 ؞7}81=f%4Bȝ5:>C'FbqS0!2"LܰC/bQ00ΉưשiQ+:$yGq-{sYLy" F;?T_ C);aob`-]~X#bA0goZF9RE7YyH$r=ۣ/3WrVJQԤՠ4:)u1ΡV;/Or>%0cml!hF e#b3e`\133{eۺdZ? v}(fSE) 򅈅? 7GoޟJYÓIɘ.e ͫw>^XI[,ݭ*|ރ7B/Cdш ^1S-/3"MdwlDoo|CLJb/tI7> h-M fa};EVpp AeTLBe"{om "܀#S;kNݱH`Yk}ϱDadSI`)Q7~Xj/ƹ. * ݩ{A ,ma;L`/hPlNוކ@? /ht RB;/Pހ,ζ& K= 4!wb::h JSO.=ؑ;CTÙ?3A%ij8^XK0K!}@c* K~:6-#:Xm _6L)eixk?SR#KBk%?DzVtƿBϨ_&܁rK8!P#?#I]װ~$M[ gx8x/:yFca8 -wtP^V:@a_Y'~mzy qR:VրJ'E)PmųE/S.QZ0r}QY\xD:AG &HKڤK%Ip˚9xk_JWut)ȾxU/X9-3`r4;Ίp((v Lux Dq+F} d>'dB-Aq?JYAOB5tEZ&Rnd cPxcmʳG,r?>,M?>=3vLy.#cgMLvO}dҭĒy1􇙉h8͔na*0`XkѪЗHLw)alJ QE1\77laCa3| aHbJet]GqO,ʲ7zQ'Ĭij@4[n AZh_԰ 9nJ @*%ʐ HBW(]_ݹDS$123pXnX8?=GI uDrc"0j,l堶n12<-+b%WjLfcamZzb:CN)[j_'Rr\b9~饺%1GnGy-&ca הW=;-բov)n= (SؖŵCvoW`;2ىsC8-DDP['iƉa:9OZ?j|td\ >? USe8žb?7&ͪܦzWp/ojZPSfXY%}@F b;9f݄Df3?4 [:BcBC\%.;&&dW"\qX lgq)PVV$S= ieM;sf'/˙m*1A&XHA}u@΃+<:; qC&z1^- N6S>G^L(\9x*_&zOSٲKΒOAgD ΒQAXD {a} R:S2Xke}Gx<*H9|x㪠HGަ?NﺾAҟDs3ǜe {B\ u!+Y>~R%q6;V0!OG |Ci%C!|)ŭދ3y, e09" Py?cMi㬎Ye D=T?2SP_B cؐNnu1$+◕LμߕEei,T"`8@㴲yG;gĒ7ZH\V=xmˀLxlY>IeDGm hDu6SP6z1CPʕRwjΗ"(rcq|~WSmAfAa4MSx1͉j!h9ZF#i(+k[-wSy2}ئA{P%x~JQ 5xDK g&Ͳm8#pz+>{197IJq+]yі/6-BeSĒ D3g'8chd`WWLAJd0 znZfgթ|KEPcl>?  +yq+f -GpE%AGLZt>hkU>sRhbȁB1X-~Ɗ]\#8jZL:ıN{EtK7u9﹃msa`0Ε^8,r-q4h4I%37LvL#i>a"3!+].#[I|()#ܮدOb'e|D}8ZS,",0(ӆ C/";Uc q`XωtTܱp;Om͝>WHj`ev2mg*yo P ra~=K 7 jOX٣g 9ſ{Dz)nXk Ns4ct9ifj5fAJYEA_MYgfScdYFA,J8KU;F*`eq,3}w2jOiǘ_L`"`m{=G:n3+.ÛI%ڹz@g*p  ܫE㱽'+6 tx\/`t|[D쬿M|-wRd-b o X㛦 z=t;;>"Yd3(̷I(xL;Z'<j`A0C+:OGmpN ;|maw.$թCy6UAZß!2׫] BISrـ8GGgcD7{gRoh>QGskʁm`&91?=lP)C!8"[B$Rϔ24d Njq^a#lU{q^LjBH*|k ݟfKʊZyjvqHu8CD5/dӽd$Bη=`"Rz`U 'y t~yj8E~uoD͂ pе8% &T!h 0Љ8f;KNlw 0mp(CІ$bg\AkB Мǿ+%a$o1Eƿ.Y%EB,ZNxju,x-xN2P1sm/@}{Z_atNWLyNx:"=Ps3/PX/*>֫05> ɎFd ߞ<#%D|}? VO Bϲ9+iڰcS7 5sžDow9 bE~t؄`YH0t2_PihLM QӦθ"x 8:?)xg얗gund>QscZ[gs1<,|kՉq/MnEH IguqmX0ˁ͙Bߐ!k1*E>"WY+@^_ڴER v؃^IMsN6"Pn“RNgxX{v^jL3@E NKw~T(Ehdz- _'Q )JW]dwXSΌ)fnM97Ț0:3]rR Jǽ tY(GMz$5Zy.Q)%sby~'=Q^ ӔXMW58oL^Z%V%;|.p(={gpil S)2޶T=רdєtl `&IP|zhc!~[Q,1`}TA}1hSjYʑ$,p՞P Bؼ>~>Ff,,C0)cڣ6oCܴf,#BpqsߊyNKOmN L/Z,IBtp9f;j.=ezw*GRtݼ5H/Bw0~x0˼E7kPqAHu/H?3dH8sgص,],y;-J_E?*0DZ$a yXSCihWA$)()n{6hq1ʪZy[(E%H_%I0O 62ƛLX|Pn\:2-t4e]KK+.޷MBRisȧ(,[]kӸ d}0#/( gX*]'LTWhTf[?`QXE3HhGƀÃ/ƌ.фNg3_fb? 5f:5Dr)-MV 'FLZ{-]`^ӛI^Ys7t;/VpN\Ruq34FT{Iz4 Zex<ޮKS^-/ ˘Bx3r{)_Ucк]tQE>Ib~{vJe?o¼#>c.l[vIҙd#BFOkidTxljlaCU.nukLC"nMS=OS"nEÄ+1 e٘Z %Dї8&%2CmIƷ0 (ɹ} Sk@[~Eg9#g&4L u5 ޼rA(pbi([,k XĘe6e=iwX# XybgҁRõa7zK2MVUe"#1X45Z"P7-5=؁1[c2OJ[* _c[RqGZI"E4[o>L{s%*|#뛑֥ b#S}l2" I_vw)eyztRV.Ti2l?SjlHQ̙,)Zƫ5|I>eJ*caj^UC)eFn|'SR#7SRC`'U970Q*:ǮYJ~[m[4#jFCtrbz&.Y8IfnHV%,jzw?[;6 fh!+KߊG [B]\3@简d)Z\1q""<>Y ānyoHm馛 v ml6G; ~83rVI3G [Z~) n)J'˶"c>y!Rk mm$ Sg'Qmt/N RaWa*0_hr@19Q&̸VS_o1`&Qa "0 JX=`_= o`G߀`sD16BC6 xI_%%:.BlrZQNuˠJ.BlTC@~_ #`pI?>gZ]S8 Q{^sf֨!:&A&_TM{?[=ctXTZy=v1RߡĄCZT`hV vRH,GStLhb\Ynv2 EӶ}bώl|6E>fb{ujÉk3IR9tZh$6c ,'/*XV%Ո>6Ҫ_H|ah; މ4%K$SxFnl8%(]\7y6;) 9×I>~D ĢuQ#uHt1=wl|9pwX1_V2P WPx爲J G2Tp^FUĜ _;@SeyGHT _`>D/uw`O*d{E{Y4 !6pUzN$Ԭ2&]U/hWYJpQ7A^25Ƽ^}:&:zީK_)[]JArG#lTy޿}8{˦쀒F23'|Pz) avV)=wH-OcJK = 9( kkvݟHɜ`yPVfsY-f-~ ']pJssS"B;2-}N.vm*y^._MsF Q`o7bz]yzTtjňj#;N?i"ru &`!7sV)Q]\(؅C{?qXX̚)БM"bн X;.c( ,0R2]XHJS:#դW 36omi&s(?/QNAS.Ϛ;#ʉTN2>sniC"(VkxOj;d A N2A;zVF:zʪ(G>(w‹;nH/P^i;WΎj#dq aemM/ܤqg\_ޏ{}*m;PP83}*GQoEG@lN#ffF ⌎LoT_|=3\% c^43Q [knzyMA("/X+H[F8( 1\Ut˕dEArZTr:.e)-[mxHe=xFXND̑hTͪ$ gռP;'E7LD3>^8qhO|ѳ>"'΁T֪ ڦF\i'I!ecoiKG[07' bOIE+_ry-7YbD{ݸG,]C `$R5KP1Bn2WE %yօfg䩌B&G;ttu 6(nJؑH uQ /P[mXsJ" ifoDE[v)&2Tه-2&<_}_`'d|FĘQpIz0{OcX3}IP͝s'1P*QjR''2G?J9zTW*. S*wA\^ WYN0_B+S,C) <=u'$ VE6x )cH|ד%upE!ou`P(!ؤfȈAp`o 1c#|O`ߛHLPݼaslx!i;8y*vrjcDECR]R| ;A3"neR5+&Jvoi6,enDBrO郻 YiݰsB8b{+vDTP[p}M)4TwVɾX*BsO%RoCmv\8}C1mj4Na a6J,pN2K( Z/F?pШQ;:-r 0tө'|q ,Dk!̤PډDVLRw}gǥSQގ$vУJw\C m;&Z%l K*P>c@|htTV r㑯JNJ{o?n V.~8lLS `1Bp8qX;xS^BtP82E@@Êgmc"l] TNǯZ7ٖ%9_0 Hi^HߡCOR(%D"JCʲ)ښ#gXb~(beL R1sC "Vڤ#gZqj"oHN-HU0D@)KɄF&jKE ]cnN/>tsDP),&m HȠ?q& >WI-h7lV*|Ek+Iu5W`I[.Qf_Eu3\m䆯5GX >4(sC!ߡ>}$C0`ƈ$c$P>? !xJI{[Zlg8P|O*5->}Y>(P:JӪh) J4/C [[uӥȢ Mb MX N_L;':b01cI;Ѡ*+Vb#)הY"FէAmcV(N3&+'j:#L]&` !p`t-x^A۬w+G'DaoԩNя f$Tz{UʝnMLEㄏcjx!-yu}+) ˸ź2pA" f_z~Puc@pI7^.]jGQd_P2?v ^}4u#Ձi\e?SOuweaurvA 3/TcND3Kh쎎.:)#jGI 8UDc7duYu"TFCLR_y 5`ֿtmnlj˨]d4Eɧ%b;arSb4;ݘ \x8 IP R9k+>z7[wKǜP^ XQbtԻ"@ג@5%hW4@eLZ 04qC,.wxd;‹!/|%MqHuQ7}; W:=E{"J#1 $J=wIl>cn.F‰$i-)lѷ[y閏 :+X1=Lv_gYoK@ȱ۪Ёu@Ak ϝGf[N2obWt.g4v|>:͏mVQ .F'|T7zi@B :?9G|oH4::P3"\y-g.r3¦71&7ƒ!2 *8Ri(ycf[(*3#~:_8@چeyV bV][jh*_`n8\A=VFp3^]\Z=m^wu9D~d9,dM+{ aLTI9Ty®'4ˆ__b0kGf7)ՑHC%2CRx$u47n(b'l#Q~D+ԭT6D}6)b2}e.evvyy({&Y6:KG0%đʅ Lr(Eb"[͏sh gkBY)qdgs B&,AVƮF)/q/1nVKPHHV wf=#a vRח-TUt8#VϾ5gS#  HK8)+aorW 1bD?3zL;Hvڢ(+!RZ @/*P̝+wPs㧿 FK 6 þ%` IV]2xxALKTHCܘXF|`XHL k+#`4븻Ķ:fhq< ht;Wi4~ _RܬY"@T͠ϡwCT0= c?"|_ T벑{:mqe]ղ$tiaeh#E>\^/ϹP #!m< w~տBsϘч%Qi 7:j-RbQ" Aӯq eL1L'uDkRA0 \ D';/4U,,| Qd{\D]@`C=«p,%O5RO{PB*z? z("'\[].vą2pF}ʒgy(kPUvVX ZWܿQt 4jIb>YPs+NjZ63b,V6;bPt#0;?pkY. ۚ4_Q D`6}ւ߈ fM?[WT[EyN,1.YVjKd<آUu"|C8Y:~dGKL&M_57J`yWAg%fX^I-.I]seIjto,}}nuwj3,V1UE5X}:>f!max17No.Iz(ߍ9iom=ډ焳-Mmci@o٭8U;e_JKۦ3FlSyV慀"?sCH+{wdm23 ̱;:*+࢞u8DyP d^&gZӵB|=R4XdU-؝?cg79BqK3FC3y:4b "a(HeT̼zB%FK#Jo)oJOPqݜ\%bmⳠHe`@ geS1 .h7tyi "/"D}R7S_.v਱IjvB` ӴehzLz 2\U)URnp\jS$P WRبtSG GFFo;D3]@)ߥ jX2Q;mS$ڿCVQUH\W17Pޙ`w#R 4T9ح.LD  Z5m:RsI!|r.̭C"q@݇{V#LC)MeY?owvؠf8ϸMXn(>=.q e$(~: g~xmucƾcƋ T6_)^Rx,;t(4$ՐDûzSC!`2l.\ojViDe窍}yQJo$E%sS4{(7xeyhG>[@3g.)CQXu؛~.{e#QF$bx*& »]bzeQx)({tx\Q*,r) AقՄlH+9oFc[W;JqE|)7Q.f}n:A.5=z &ǵ*j$^8+Q+ mLTP\w=ZOT4_1%@7PnM*1jA}BMx(IN ){$,-WhC(P<}vems>b]6WCZx#)LAKǔc*W%)Ugp7)>ԪnY/EQ~&/>2Fjvs1D&r#Y㥡駣r@P,tcRHW銄w8j6R·,ezWn[qF 0_=#p%]%,siu/lb^P}rQBEɈ[|7Vyb: ^CE)bBԠ eN8r3sC.2^QȆYбy=U/zE+ zo]Y8[q%ݮu=n%VB8ЋėV{NTxɉ29+,}F9aJ=E,w +k+"P)uljl3xTm1cqBcr@߸83ߊY¤l \U뀽hni ZƈY<øڋ?01g$PyO!H8Jvwwrѳc - ) X"C 2x1qֈtKͬiz/:I@VIh/#DEo42@v1a1X+ d^t'/U0 wj_4XV~~u VƜd!7/{xtEuEgis`6x8~48DMć7lz7շi ˳ ҩE;\f7H [ԧUz*w6Ww HN㭘M X=[9.aݫ[4Oxn/$|Կ 3Oh HsIizV::LMerV(M }d ZC.bꇼ ƄOIowثʸΞ~?6lqG/W_8@r o|}:giu6rC1!#'s~r[ZD |LG;hu|>EW)Dˈp0w>RQ>} 4fi~1jx:TB+4/DyX^(b$蠡hg2*6> u@_?Nb z]3dgN藺r!2>)B+k4-; NQָ rυX$+* y`5:xӅm*1´CbXK[+V*R8{ĭыCLrNΏV˘!UFVz:'݌›ɽ 뵜9(uP55t3Q&tp0@~%g}>90Ž?)T߶T}m*sO"N1eAv1_ )&uˆZKv~^;#} J1k|B^<E *Ӭ䦚o[z<݈fҗ~·}\?%Ĉ: T,_9T \R [BLt?fñcR˃d`Ԓu`J"u,lA?Dv⥌p'v0v-278.hXc6hCqIv \\PQ,HNY;;ѶUnוJWp˭, N} nn;Z&VExb[z'EK:I䔭߯{|1=.Sh 5Hxؕ  ;텡a,pY-^P 4U?ED'5{!K!= $rYWX!*9zVp.h#"G$I:4s{Ȕ&#Y贃ӳ]> $@_FU.oS1+)R) ĝd!=*3ְK8<_j5;"}L~pceߖX޸#}]ž{P>xJ12?2nV:Xi3_ rrlKO*oSBB~M{"~CKv ? V~ V3ڌ3 :fUTR(F9x'Z!/,J^s?Мۿ,̓BJOI2I0A(DrQBUfjFCѐXb]|>VOumw$%p'0ӵ%5QIOH~fN텒ODń u{5.s"|0=WǮ-)i"trC[NVPZϼ"E7@/pfhU mvIտ ok&AC\W<To}䈢7kN$=2] h3-J 9Zob`[/)!.`jEh߿Of)''uo5{`NwC+]n)fHhrϲ 'fh|$f3N(@U@;{ G:rCH[EzoXȖd( ?cFuc ^[p(a+9J啌j&~G3:4& - G@flM;on[!̍/jJ ZǙ'&MNXE!%ݤ64pzST)dv4* Y g"A%R?6/dn:5۩T8q\; "i7'fzVpȌQ )}"Fb!hW JZ$v`f!P牠 뵑X1վxд?)W̤`:0Lzg0>^˕PW?m!%<&Ł K@${OFon~Q{NǙŕ{}u8aE+ډu(f(\&c+܆Ä'U]8s)=/K9oa8”γ&?tHu~j"V8510\RN&3AiRIYU H^u~fQkdz`LL[7 Ab&j~ѓlaA*%!76x)~7: !'YܠBޘwU]=v! |H&v*",EɖTܧӸz8P+0y?b4ɱwԡ=8Vc^lϪECRtpr#[S}h-Y 4`9wYkԚ[JPrpBo p%H4ɡGKLK1AmOrc&nL9Ad0 %yFJ:NI|?J*q>P1@47URO)V5l#Wy Vgr5=!ʹt TwN;_f)ҾDV[^ Ac:]+M'V9h3!4{YDĮ5n믡3Zq|*]pԛH:N N ͖{ E5U=5fy6&Zd+lsGQR O+.f!¸|D6nKv {fl7:Nؙ-SXdwL͎*8mOLWӻ*0&xXPf NR M0>Dee3CF//3m8[Y0NɅESp% iEj(bt^ςs-/欢بKBa@7"!J`h9>rr4 }t+5`KV7pn@fij8MV ;,Ӊ=y!Eܖ FO`yk_Nņ÷v >$p/ia4g+]%̠E0א"[V5YBR9ݺ)yDze3iĮ4-3 ],e4:uPS`@rq gEUT=x z]$T@BÔCnW :$K\B_ jHCJlڑ>q[xKj5zqr6<*S?E$Ppխ' W} FvƾI5Y٣kO. %A;@*7\PGjJVvo@twJmSu1%lC-2-]Mٯ-Hw&)Aaݾ '5+bis}dZ ۯG~AЋX,N\lRe]%/[fmt.Q_0- 345&:8eB\벁Td84l3[6[i着?^gJE:$л~ uFb@ȝƯ:>:ZCq]sA C:p?-r>hu 0TTſD/ق{Ky擄AVzNR3 7oӵP}q9=zη6c{!HsrX ,I0tN"PWDj v*9m ڝ^ԿGg/Tzaq=Sr3)0WYT'}ՎrhUmZ66~(sȇLHMc@ᭉ:Ɖs_="Kt0Oc*^)*?FD{+K׏XIJ\У\"f Oçs,#yUp!AV%dCzjغQb=,O1bh)8sӧ$^OVwN᫦6^r>J%x[E|;قQ: `bmz:B a5.d8.唐 )vpwBю/pp1 ow*fh` *' Ej#zE3$Ǹϭ rpaď6HD罭8|FL1HdץE?Y "-kexg")v7\6BA$IWzl_4{y |j" F|י q_9C#>5AZmM~pT}d*Z TZ+xNYa܅䯥 4B2 rW ="`+rUhn|"jb[\dj/͖iqǯXQҁsDƉVQ\|EBɞr4h _t3vTtՅ.F& JƄ1@(ѰQ,7e 8qU'\\}_R⦷Z#4$?0BD99G&u5׋ ޛ]\U Mްqe=*k$_qC҅U%iG/U}us7x=O[pV⓰uᨇs?'4Gp>̇Y㠻Nw9 ts<U0I*(&/7= dK}*$.QI;_ Ϛ1_e[6x(ҘYg~=1铍oEJ3<= -hR)ȖIp C$Q_&HtTpek z"='u`qHLes~wْ 'h,ز9vZKإa,%1h zΩCC,ά _6ɻ<Վ{> :efy A0#ۈx"E+@uu 77kS&P xxl $%T5x!:y>&e=Ypymf97J\&/ϠM'*&q#ݣu4mX|XjLP钻$Gc4J 8V&rx ɋl'[;X!U?_%7z2P֋ ..}Zs֬%LFstuᠷ RCߎWt9 AuI|xP6\H`@օt7EKJ4ȃF*Fe0#w2JjI2:wSL|e4ԔW,:Z =ȑ yB)ŋh-zyQV\kpQ#$6w pfCd؟46MOlG\g61L*4<}2,·RTŗ*b@H:B38=aIlh֟HZLzS-KtjV.nFHb1Y=W;vp2߁V_cUzR i5(-6Bxf.'w׮{Po3,ګ|6]yx]mT*!}F6oƑ}aϙrDDpaӓ=iʪ}$3h43m ȟ)oq}NG0LL=+Z?>alWf9 zS\o2nQs.Yj8:og ;Ja% B3?EMfi~'aa;u``CU5HE<Eo1 gU 8B4>!g-ٮ&(cL?'d^B^tbnM )~œ%e =b &d NQC7M|ff,kbPvz޵3Cu4rdE~C $RwA0 1:A+'KFdo9>5jMJ-Ӑ.n^c$b dm*Xv*ez ,H~0W\JZ*Oίݰ׍yV. nIS;gs?MO'ƏORe&  xΒm`\t?D pcN?m^^ J8W[+K\$;ȱdT#'Wp 䛗E㷑9qNLMGqQ$ Ł%8θ8&8!1ooJ2LuL pV \ Uҋ|845 M30enQ}50?RvƙYk0QyNۙHACrh:eF &>VQƢ9.O/ӄٴԽ UtL,eQsf'}~h 27WnX{MysY5⌺Z"էw,^^kՉ29U{_t ]r>Pp *x!le(bKSAG<;BqYCތ!{8(CIXLƅv_\F7Z.j5Q%Ӕ&|uj\L fRM{w2fd%ע>1WM悸ͱ@"THSJЃˣ|JTh ž[ݬt D US ,^g;8װzO*;]ߏ|x3¨IRˣ}<_KjFB. XdUwojFAj"v箱 ȍX{:Eyh}D(ա,lf!zTeK꒹m|2lz@~#.t"&Aپd^]YKT(fypJHIs։;?G_~e``ﮞ;짞)j^>|~BBc ok͙'7jztcHsK^~A]"iL:=K+E,t]kUcw)h7')C})y4 $kWni~P!ȍw#? fd 5f@N)0EkTuOUD0LHU&>ʹό'\55K0CU؈-GdI"U}RRk¤NN_N-6DK/v s{E_4_3ȳ2!٘`H:W4w)X","յS"wGy>Ev/U 9肽,1ɂ&wVhZ%y;#~'dm4sɒ3VAE^kZ6uM>6ζ _;%5|aVDsOpg Qup_?%w市~זx``07ܹgUEֻSZ8M/]TW 1cWWvޠ5[߫sjl~~sڙ3=Fg& ~URg<)T>-\ ;1ui2!&K})JcCM6Qд3>ro@-H@Y 96sԶfoN(yD_Y^K*Onr_O'I 6i^p8$hr=W *Idi1G?8_Ln M!xGZ _Bk͞o싾T$7kD~4GZF^蘊DKs0#s$2Sn ե˲4)(/.V9>V6C"JZW`R_6 PC ,2( V )r{%1\4ԫ'|QBYKR#<[. @l`Tf[,]^Z'^ /SBd Mb_.Ʈ$ڐ5C$__Llw`2>+â=z<䌂چեJ'Gib+!*O%/n!O"b9F{SC0b)3D-So3{\6\zGbR{̸OY& ݢQtqs|qSKز>"7~wwl֩n "3*.,}*\E&JvC=-Gq}lUiڃE鹜 :\"4&GxnALS=5O8!vV +Kπ ==;"ze.Y`IF\C*U9cCN,]RǸ,yn) ( J7.'pbt4c>j]&. ! = @?y@:c_# zhw:*A;.U#[z.9r| 2|ECzФ57N|{`(}nn?RY#-|:]/VXK/:CU0+Fcn!zFAR2,ULw7(`x\){`¢4U rl1iLh@(>HpoBӥRF^jYr& t?pxb^x>ɊOU`|k_&;hY'ڈ.lc\AO- j(pL@9׀eI<F1EQjnmf=ivQ]Dxv0:I&1cHwkAƦG%qB'7j'U8N&OgtGltQ@u)(z3 --!E_mB0W^sWb:?dxb K4l*ӈYN= E=&jU &Zxn&m"QLj,Ui^k3R İZfs@n'OrCVjIJ<mK/H:V ]ѳ(OZ LhsOIV=V:Crpt5L|0KfY(?RcO;\Y榒x2N&Daapx{2| 7rz no*͞2pXv@MPi$*~ܧlz#1U)O%mHfN[G6Vi3Uҷ;q |ghD˵gLFEgb?u>Xj;l#_%+WDD gKx@ DlaQr`kWݥv_5DzNJQ5.f?tK/BO\k9闅'C+MTc4nJa[T?d8-0M9% /A[ڽ륈@ ٫1o S BLFaxAvLSPO['vS)`eYwvgt_$gl]?[ŵpuFQ ʑT6thfjBz6-o|a?W=zrDgeSz3ڗwZ#bۥ:.ɲ?編xpJ&O@q Jm|Ttxq.&*}VC,aZUeۢT@o_{?arQkOOр/φ*Պ"@tQ?Jk. [w";/cg U{w iS):ڑjEb ы$, Z`w笇ijqU+*_C-]zӱWbd"慙▖,(+5ok-|Ψq'oz?9^7xŶ =ƒ8;>ў7"Qq-xafpSÆ)U:9qV"xr+|,}S5P#΄zt7ҾԴKiIhkk$c4r}E "3lGs2 ~ivH9~V|_)ʲ۳\t#x`R7Q7Ub z/zjrQ5o7>奇nPb53NjGZs"g^a-TU59F5mApW"1MOZ*BdiT!h -4ޡqe =g!DsC!sCMfy(Cf $fH1_NJaJ$8U/8>Io6lؑEߝ.u{^ڼr$d E>& = w(Yyӡ3)ׁ5/MSo/3G6Wcϧlci[O M:3w;U NF}c^~QVӍPBC՝ k[~gRc2ZiTt81_=Jk盏.[vu@\':M+ v~OAB%/oP(43 m.BѤa5 5!a e{]'!δ6'ݔг|`[;>(ݮY#^u9gV@`=@KzWH{oFoP߀UPҘ\sa4k WA K@-PkE tcR"W>~y\/Y-Aޏy4;9M|;AAD'cv }Kciг|SYBJ+;i˘Шl<@p$c6Nx=yk F1=IֻӉ}MYF2K`a~N=exR^,!JP רAo݀I^Aΐd(%*@V{{`[уQfMH\]VVzK/bj'\6ҩn8@nu6r!3^n{DF!0B:2%s{=th>j'#L"5r>7v"KR0=ӺvOTpaX׌ue,=_&ךB Y0/4^fjG_H&Lhw?[ 5d {ʆyVY Gg<[NCfmKL?V;p8DF2r* +"ķkj2c eʝx()rs)HKCZ]0GRj߱_xf\;LJZ Pl= ~W:퓴s0vRuiRGFvV2 t/c*P"b#mVp'JAX_,n޶N" }ڄaBi*؄EAU ># .l87^e JN->[0 X$ղAͶ)8C`~7zB mR/c֧U6[k EνNAfHTC߳Re%hJkȀma9u Kji;^C8}&-2B%fy NSoKV̫ |*&H \_eUnѮvTLQ)S] _ ๠c xY[^&VPct\`QÎCW V`Sݥk]&UAC@wTyhű:c,Ӗ =5lذ8Q-䦰X6eU2徬̬M mn:$Mn;RRi t }Kvoy#LE.d5z m' FӛƔsbl.t`;Du*׹ߞ5)l)2$=G$SNyhB*8ܬ|ji (a!Rrui]h&)G|saRɾwo:Kef{V( :^.ԻRFW"%(>tէMM~W{IUEPУACqpc#hUS KN :J];J-~Ԉ}Ѣ`7Wxʶ'tP>#1gC)%߭6H1kg/¬#U.̎9TY;h$\2CQtקoP4`C$)$fhSdENcI7wXܮF!_0`޽D~Kach"ѡl)l0s3Vx_wn|:^Ek!CI[5V]UusC [9 x0z17K G=Sk4FRHDKd,Nw>QS%" HcEƣ\[-32"΅ABxZ芯G`4,N`%^O}FO"h:|C7Y\O+6x1 G \A ~8EC\c.2LJzmy q?/3&Fm1beߕ>XT/C%Y3#[;Tnm>`^K x$̻PB`SiؾKbVTVpR *{DC;IaXz> 0,-&l*oǸ"7@y8 xWB8ew6Gr{I-mg0˙za1 kTZLcZ̤efT=K"Մ΁( ZxtaUݬg>Ҿ?vu>`Ϝ/Pbb0-Br\>9dy+q1dl+FcsMu<4iij+Q ȣ7q.HR1w}buNSڼ')O#`XYok\,֝\@VJRVd}1Q[q6Riq'2dHob>I/tL.vRSYbu4\\m g8Ǒ>{BL , 8AOJ0L]H"IpN7ۏinU!P]g{U]Mq9"x쓆>:3Oiks0Q 6lz< 6+OHA1,S%|e7!W2|tLxN׵x! uHRޙcTڿ 3A!,yx5چŲ(?~2Բq];K)"R`&a$?)n͋ h}*X)@6AM6XRuS魊ԣtNjB¸#raP8OO7x 6|zS#Fӛ75{0Y_et ,ʷ p5CĤ;^aҗ.b.b'K!qOUTO4wBVQwMNܰޞ50ĩ#*Ǧ U03:ÝVb%VYޱ;8l,re\s%a$Ҁ)+{ce{G&*YM*}&75E9omOF'U9̵i&Z@R 4A|-?)?irL{mozd>r~lZ2gC;ecJ Pt@2Ǫ>5gpϴ  V'9'ldE]*1RzEj]7xJ=9L_Jӫp5F!T~Gy94EO L`Pv, cTAP.g&#ٯC2ݎm;Կ֜dk<12=b‹S"¯ Ԝ3o%Q.<.U&P,O~>Z?/l?_JjM^1ZFT҇G2$(z(ajj+0Ŀt2+h*3gZA8Wfi[rJ}tmrK0޸Wari:@dL;o>s/j0b6TXl%4:{/xgM{Κt0fɝ'y, 2Kv:cEolH/A?|!h늒k"TJQP i+ ?2~=|ŐO$=O3^S7L䗮Ӡx2,&LaҒJ*KЅŇ)CpJY*$@12݄m@WNT0Vپ uM/u?R`ZMtBǺ;ޛrD&a*f9d55xUt"I-d (G+ I-sq4 6 R ҳ(y~GlS QF`8S61)ʽĊ} NdS-u"8 rE 0'ODkV"/ZRU͏%j3dFoZDDܫ"GE}3T),.b' j?̾R+uJHZ@i|yӰzE~Kµ]F L"łrzD\j9C;Apt-CP M]o= &R*9+3UJ%Nv% 93+p] FXL;(a"lgESmK 0apl(BJ7n0p3-M5H`v{E?[msAfc;m5cKFm̑x; _5pm&f]3è 09Fg-=Ts0wlur٠_I 2\9nb6qxwR뷤6%ɅCm8=RqUM4)flvuxߞ }͏\ޓQ>RsOsaCǟ%ƞؿVp#/ .JRӺix;Ʞ\]Q =FP#=^75G;-tUhl`KA>3UX\@ӫmΊ^楚w]8->1|F$1a)(wp *YJogJӝ37"Jzec"s$:&:W48^"gFrJfS>B+aܜO)J1P8x,Z2{fdcEx 1ʠ >Wh'\+ߴ([xU*wzg)cvM5ANGjeJɡfNI)|擋.qjO=I,ɴ61!kih}@3&I7ۊ$AO'e%6q>Zb{@#{E. -!?*S-\ܖa<LJzpCU4M90oҧ=S}Z-j=Rʟ$IuXi٢.Z$oRϜ$6>o/BWBKSIT&3N/) $0,^c;ְe?91d4>_5Or+kX¬ܯ^rs:j}£o) rsP gDO1YH?W. 15?'0`L3jDڣ?u?~L&ӡg*b2Û^\ɘL qnG@ޙ)bE|C(m 񌦧|äX?)z5f 1 Tyqi1sV^/@%zcBڻ1Ry+?iZurzyn&O$$`9=_,%SdMC$]z1ß o `P~Y^lK|&%9u塉.YTٿk/ɂ٘SX)Öo*V@sTPDc' GI%7^$;_ڥ緘JTxjeRǹЇOxYD ɮAoIכT~ ?mD>h1$p71TC^T:-R1 6_9| Mg0ؘያQ7Њ;C-;x" !9gDiK]u.$\Eyݡ@ R5@E2Af9CÂ)HX;Ë'M AN=P#4%#l܅M`ealo=ijdD<yn29ݦU3pY^,':6&˔܍y绫4E)Ž 'Tzbߔwi|?pysY9)ɁBqО D^C?6N~kǒ^dʑBцq$ߊXR +h#Cj|"Х^5L)2K0dL, :kz`|л{5# 'O1ckGP{`՛Q|[:r˨?K:c!!݊сlSonA:y2u0 a)Ȅ ʧf2aKN`hw75 9]w|6|<.ch)PD<{H1K/RsE~w̻ V ĝ u｝~ ߪH䪃H(Mv^=cR==Hӛ51q;$C'1ۓ-%s%uAmH{g5ZұV`w!toy؇PG]Oؾ#G a.;T:: Ir0Wb#E8INJUhߍHCCӲʮ2 >i2tfᑃ~6J4nSIT7"7`B8h ed%tQ`| ַgڠYMx4 Y\5`~/A8&sS!!2AbM~G.vxPy_cClӖo̚_m|g O`~Ei&>Rˈ*3Q|H@[D-?B]UrvUB^5~1%a!FrUW e1}Nz(؏EgrxyB^f!D/.>LA#U/‚*xJ \s LW7Ylг"8i}C+_D"p>fȁD-(]8 EkZ#qIf;_?~_-s‡3 ʱfOIKՓ>!ca ;l)VA}Hk G}|3y_T/900z30 A J?y)!7œE@~A[o[ઔd-4sK" po7|[Mŵ$7_%g/ 퇢;8x̨ Yx:(%"V4t;ލr2JmI3;ҁ !zѲ3dt1b6 61qK]s*6],VIE!vާ3^,Aq,N  @X>r!גvumwʪ*k)'JcmN[9v˒ִޓx{8r&<Ū4sTh5؊/t^SXrW-wCE^^h*n 2Ǹ-C6ȗk)*8~|Ѹ7aZzz]ʧT*G jJvy f2)gbym4 #4 xg5Fo -]ՖJW_ޔ{P2"7=x JT,48{ 6z֮"FCRAj3XeP5Xc$3X׼ ߀b^7kC8 &}Lg96|XE|f'LTj$?ұa>n@M*pX Ci'EYРfy_Tp62g#w"{T[`q8ॲFg++=_7⓭cV ǛƴO FZSYž#s=]55Լ0wF^ڷl"?$L7*pl]@{L[5O;@ ݻ閑pN/ɷIVaƄJS"|+BaexN/):i;Apbz(WsH@!i)/r|LŔjAF,mUdpG)%Mw?Ty#Ջa;:CkD @i]9 "ysۼRxEh,{0YaKZ>b1t{YL? oۀ J!uM 5GtW Yr2Cegl(qޤu3kŖn[fA?Yz>FF?`qUIJCO5tTݒHԓ׶7>[nw4>Ͽ(VAEO ƆIУZ^)Y!f}:iHpC fuD `*^ņlrB]KC&_x!3~+#Ԋ  jQi#D&;)8:"$AnCp"m$~7vj aX|(US!d:'㻣.e>V^?9!]h1JoE hxƺ963UHd+A, ~GPOD$G2G<>%LX.n5:R8CH,Tas9t˦aeڨd?uq |wN2h5WF ոt⌶s@fșa nꮽ0lr_ Pz "X?\T v07Nek:T@H g@Uـ qXo54'߹>zIdCEHhߍl!u|qikFC(6uѕb}BoTo-dX>5^hOUo_֣t:&48_o8qSQc-*<,@ 2R)i ENM.S$G+?%,+M]-A 2Í 9CD迡^A(wziiA)ؓ! !rPpV'|ӖeqB~WC(xVwֆ@(oېHE3?xf#.^YC06k /miccj q=^|b2RM[.?W}hMfP?}4qo~IC3F(W0_&١ecBeUhcNn~~BD_>ٽ*Ύ hU&'ŒXb#64&v8&;Szح a0a>Yu¯ u̻h87Nh1V,Io#bԴ-oPjk#m}]]^Y<~cl]u+jkA6Ki)lصB𐬻t,0y/pj #y^˒34<(q%h XF>ZwFߺA zYsRas>t29 D/\­v,L9p'2sw,9W&^=>V!LKD谛&,m{M>+3 _F:jnEXU˯+6(`SJz.WԙX~S=So vA*"X XhIBےWͰ(ghۣwv>ȓmd !#]j14u!$y20$϶|@ء,6E᷇v[~[IG,3N `JϔWȠE'STҖ<) 0w&w4< naԔvuU< 0I}TFY>A ˖3YXC4- ǯrhYx)w2lzg]3F7U3qoQUG6Uo֋pZYkȓS((Jdˀv`2X0vծbxzq\OK^Vw|}.F\Ҏuoeg9X|-C@rw5u!cQj,¹ڮ톆^  [h@;;l{E'(mZSlg85'H]zk0xnQґ㶣F@~ b[/a]$m}6PW+tZ:MW wTB8>H6o_!e.ʼRpPyB~K;c(h$Z8f p%L~KkL q:OP*yŹr2e a-AJT94pcBߎ^:Y(.Mq ZgIMtfHm$|3zkGikGS.re۬:0 /Z3́~@ÇnI4H%r5Q0E TV8)KӉV?={j --}Pt'3`6WHӲYsBt)6GOzGP/IzdfsG:d׍B\ ֕.;;Pkg>: 'b X ˿/vBH\ k }# UWJs_mWU%L4vN0+ 1k&B<4v>BMۙ&gֆ0"H_%"#py+䶁<"X_赍HNPۚ<΅YY+OUVJUdA*!ژh%Hz*p9s:Gb̐W}!Dkܖ2}(=D8ĺ"sBX5ӳn%Yr:% @63%ӨrvͅS7TK`&ZC]%ݵJzHB80t@R0n~U0 Q !!kTo^ ~s63Ʒ V\|BVZEfEiW4L5_;rWto\Tn73"7߸MJd+"ҐuPGOgҹk]ڨV&0zg,4XlQ`{1C]x⋦>i;^0]jS>RcT xEDaoM{/$m(Ys8Ys;n3 ci-p")=Eq/T*W&u_?W*_E]mE .UACa ߼ ǨV}՚e g6GF c8dΘvQ}y)ǜJ=xRrL.II 9ö*-mbPr(~\wy賍;ѵ#nC"L(|;x]x}B 5,yں5+)|6S cwU kUx}+,=ݪ,|Tީ/B"Tտ27Et#pqXB߮ Jp/HLU[[@*'\Ѹh#ѷ ד1=+i9_*A@OI c,*)~[ 8쬕  -"nQa Je~[n[]齘[U.)-h8*_S5n{9SD@5TX^sG1e8-"a"."7InF Rcxc[-Z8*G= Kmx$ZyGUIQO19\!6vfp.s2=G]={ u9\<6<"ԫـ63Y:PnzƝYCR0$>5&e BW'A8[.f)`ٸWߏAHy A;$%ŬG#L]`w$-*e;e'_t-"%X ̤QiޯdxISuG9Fj@;"~cnG<4P{B9*ϸA{: ؊ΩpjY4 RfN $Ę8s-$CO䩂SgaJlˋؐA/L,! V"Z"!9;& Rq7 ` 䃤# P!byqj\RcO(H7;AoFO*N%؎Kd2FL"T4}R (eU)-Z87k50$ĤD0ň#"t9Ud6>6BWwu= 9ݒQ @[8zju~#??pWQ-##ba| 1}NjM2i_(ȎVc{R*t7g/6Ӿ _3#bt6]BMK:?z*P3b`0EK>VdeB7KpYKV<7ХIW)TR0"s@* XOсLfo;W=6Knd/1C) ]2>`c4~#֌fP8>Lz#֛4@NU9_Z,10jƘLU-,)#DĞS&'#8b.=NCṨl7U7 -UH)^1 t0Erq'<ϬLb^- `@OdT$Jɕg)c<1ro5T|MNKq*f`]nt[7nE`U-t߃fw!; &TS xOS/ᡃM qjd h$݊I^ZCD q`j|96|gT=){@l3!'͡MƘ?) q]7zqvCh#ѕ4IoV#_QM&ܱ-;6?P8[5#%jl|/1M͇8@]PIP7|7x]ݾ=Џe"x|{ňY1-,}U9"sr^FM=H-z_aj}`EЋA~ݗq1CB vC#1is[xEcz-_GR\U'꼕i{o0CDiO/mH`Q BA}Nl$p{RKOvװO@".dhlQ- R%siCF?aF?~N0i%vd3yo}AV܌K0w{59doZ!- C<ŷ]*Fr9ℽ98'6<&䇂'_E{jDS)RF*n3;¡!Y7rC;^(w1'XßǺ6Sl~?* V>(*/1\`=/<H 1롬䚋G-Qf s읿&~_1dlr'`: vϢϟPE)WcH+OR\iv(*2[t2Ѩ #6(,\r#)y83r_*39ʸj <3>[ӢZ<"{!DB~RwzB`kFEhSa—@nӍIMp"п}4+\缱gtir9 Tx<2yț hP[>F Hpj]`SZE &Lj da+<^#I!nEQb,(hvbl-koay3R1(C,zWMeC*E׃Ad>#:B77P߭B~56] p]7|caFƬĵ cy z(puU ё$gqR鼒Yij=3:W"ZVrUՎ xڇ`QNF5$V{#a#BS)O*2?I53I8J Y\# ʍQ]Nt}LbJ[SHWۭB@(>z|o Siȱ. p5u}{oE7!eXxsmbq)^o( WNfq+G=;Rv.!;3fCl5hYJqC]j4G8 (L}1qj%4wv7|7Y}{]Zҿ.ԑ_ 9T먃(`ۀTb߫hNN& g{VL5oU4EM,_?ā҇H5Q1kNP:I'ogDLg娄If@ЏW/b#ykˋ)S[ W%F _ŬH N!RjuСqJ<ԗ-d͑1X&C:+vHZ*Y} #PRf'f'ƨpb=z?W4֣IV̮JY.|IqoQ(8K.fҁtCɲI6,] gՂHؼWO5CdX(k=<'sb,;6 *6:ɔ@=Ut3]C{!g{~ i6trHb@n86[v@c}pU~Zb?!T`[b1Ӌ,A<.CrVq܊N3 &m95]:`{ s/Ϫ^{_q,[ 8(ߔɍm~)׈d;,*OBA7}anQz~Y'c'V:Z$BeJU:oH2MXa =x(oŦ0?BjX{9/lI`F' B7O/ @Q^Lw,a1}@&N7 QWW")2jSeƭlI!R"r96H,ښlp ˜ŋt]Tζx2.gȵzdbUFZTW7/ XHZ,v韂d Y7+軎>)yê1Bƶ/"ު6p`Vm c6t^(Uۯ]ulHjCOxEC S|ޥi#Twa< M~p^1Wbޤټ ֹo @ ݪx(]$aUb9 Q7}(O}fA ,JzxHPSEڿ+`R>yR9kt*4I[@j3&eLYUr>TK,{0LܒObܤedD~e/M<2CҝT7Z[,W_lcf`z^ ښ/Ǟp~D늱F3D+6OgFI JJR'H;Yu:EAнNNw#<zm{N3b\Ɩ{z%ro<\7_e^Q8MFiF[-f]6#$%TlH )AenWoZI.0Anj;(]-_ϖ|PR(:ejB\l/?"s7t6km+YKH*a @o42}ytGlKe=!5ARtګ%q9Ax?tQ2;4ڧ>\7;kkx@sHOf-=ʼnͶYiIװ]vR[{ss|KʄlZ岊VrR1TfM |j+"3?X~6ʥrs)siއ^L&"e*IFd}O#`ҪQs'c0GZEF\<£@KŤLX80xjAA;leכC#xDٵF7a2%M ,v5u4ΜC2ׂckB}L KăM簝SZ5+uoB5Mk뫼aam5Νө¥u9mïb92 s&߀0_! k6o3du' vX>lAߕ%oO*ٶ;th[Sܪ߉D+@MYLcV'Vm AtdߜWiѶ38EVJmoJuwJT WBNE=0vWRS-)&B6~:O/XۉvoTьqpIO-Fb4<"'i`@eF3:Yr;QmA'7Ff3B I 3$| gKwucr(kxm_3 @׊ b|$dzق< )H6f~7 ;Ѣ8wD)G9Ox)EaQ akWZxaWޮ|A,jfJ;S01䆤4lvesL?IsYP@Je"tLCʹ&*ԅھ%6LATB'𑩥N+ĤD(i&QF^쀪-3hTN٣r ,gB׎p@:&p#F"qRaa-9^S z;>^Y.=Z=o O"_YAV`DrA^j w%_/6 ڰ~:02HG+!"(Jplj]5gH z;sg6Q'0jBwlr3;eɳv (BRѡ9u^8 ֒$U>dЬ(9d!h%3)g#Mjd)Ga9NBClQ0Eh:zu $*`$0^/~CHڥ =Á^VqV{'|]l:0mRY=UW5+Y\ʱiR>k2-A6͍ӮYO y5 \Ht:$ |5eOڲ tҬ=]I{EXPMꇚCt]OjtNK;lBAS+~9kQ(qB maGҪl &p^s|^@Ґ@Qa GvQ}zSoSi},> ަd 7u`~dՙN%/ǺPC {ɾKd<C*)%ȁ Ǟ:nYT!6q0d i0^PO6oæx|ZBQRc> eь$b$)I$^ Yd83 ޣ4QRl!^SwE-job;8sCUDJ|Z Z1Eefaf;8X28| XNg[v ݂Ohߺ]=jz&OxX0w)\ޞx*(Vl(kLӛn*A )5G!L+*9W\!:ۭT 5 /8%NHPۆ]̶nlzWF\EW(4"K|Mdr7Q XqdA p:J1Bd!B)*0@%\(\ ȶ$&$tf:1{4>{xr؄SH`},&5מۥ&V534ҳՙŗ` r/8 9{{EQd<f/|De %yly|*Hle EX(aVv@2PO&vr(:P_P2r>2`tPl[iI\< ^F#ǣV4r4FOmǓ\H PćFWD,b-7$)?aݨԬN`ha6*U]>;E̢腥'"B_7_C Ee]gu˱PrgSG)S3I% 2bЕ hg?^DMoB`ˁ:OC&^ OX⦃`jW +YQ m+bi ^p;0rV"e3j*Kl*{z?ZFTHxwE wQAct:9L(IZ$7ۜs6{eiBZaBx 8#@~b =&]{Y^**L &pȵ^, *sjЫvVn.Áq*N~Jzm -id;;4.`\"\xE@"Fb%IU,:1 ̗ɦMS &'$EY90P ;lY+,9 %njS,֣~T)^A!erZ;Y9m6_uP= {\L3Zj}Hdž-WL"#ovwxE-S—\Ùm/n#APŤۍ9 սz:k7a؝:Z6]Iϊr'ިZx267E.׹d-ڑ+tZov `xU}(b6rT9:SZɀ'0ÍBK Z_ԓ\>gt3, (\z+]}z*Fc2U&u3Mѹ8U.{?<l.vͤ*Z j H%T)!MTdЗx1%0@ Eǿ*yl  ^ !9ZS#fp6D~Gmk?"G}!cwa_ tpY`8W2yu-K0|InP䥊3IÒY٩mmCpPԆPF%E}KfI 7p^zOJ3clys"D^9@?]@Gu@3^X90)(=wU>yv%*TaRN4cAȮn^m Y%oB1MxQ.kۚ=^s#D&Hy%Ba}B@Kg<@AwHW?[r_$!p/Sjlຌ}cgbNb+^ԃꑅUZ @FBZ^Msw] ]/A0C-1bu/S/(]b U;[2۝gT )WYO#.VeOXoK?{G5O .ۇPe*BZ A4[￥#Bl8XIXHMFtܬHd&ЏM٦l\i2dX7$Τ]q-)"ڡ%#{ W5r_E@.= }KitQa({&+ӝ7`YF+Gr!=,j]xœ_E'+S[ b!:0#>9>7=#ςȁ s_8OO<(h榟ÿwOm Ϻ5מA P$y=9W$cKψf^ʇY-QjI:HK x(q{X4C+U %Yucn:`1|<a-XkZ ֖Unpb~f:b#_0WћWl̥['`w s5$ڃi"޴Ǻ(v*}7j_Tg‡|Q )V:KX i*8 *h9UWSÓ! 1-|: D ==KȲR ¸2dՈR}9t@>Ѳq&Q:WT=E@1ۺ-KX W~Q4y*X#Xj9?֠g琓9ͼ wm-!kvzm)쒔Ev{ ?NJFf@+B v[lzhgM^)F6rX8dm:j*Fe\iwuLu%tiHmo]-Ypr8 $z75n>tq@sQ 챽& +]N-w[}9Lz?䏒7'[?]eKd#k~H1xvY"[ vp2^_]Ȳ< 1pa89Or/J{ja>۬&oo+qJ9Wy%V᣶PD3{]h3 64ԕDS{ 7t::^.[tR?)@ONrDuDZ)/zkx:.u?Ss|24͍`;jqJ;;(Ew@k>3rB뜳CUFARSļׄyxYN>D茨]4#@er%+{4Vit2g$fd$B{ BUQӑʹȖ`~v{ wX3[F;lxU,B0&G 嚞F+mz S"GOMs kZhZ!?7&ws(Q\QA*eGf OyZkt3AĕqU&[,z}pv۟W2H:ϫv`;}.ݒ.jbsNżi ser91MM͖U`MQ'jtV=NL+cVe(١D&1w?ZȟD-Z<t}e4<)T*]n*V#؏]p?i榲'$ &gi9klL{*.6FS\^\9azc`th%-`KQ=0BZ# AsdvY^>B_^G€E~6[#HHA]ĖCP6ݷA)KXMB[zӖTr[5(<5ے<L+\"ޝU D!mq=_kWĸgPYsNiU[%XYufhJ ]j1CӅ.]don阩; YhY"oC/HљO'*WowTw (WPSmbo%V;h 輼WL˖z_9 w{fojEpHK_Q?P$0 Ҽ{ޙĚ'<#XnʷH~,;T aC5k/#YǤ6>]- bݹt~L."g ͣXbI(e>xXB[ "jCRaO5!U[PzRUQ &F,ADttE,F) Q0Mh mj^}1hpWs" \mDcUL\4)o .*d4ӹi~[@aʭgA]-]\ eU·8?SbmgΓl2M- H;ʵteH:ם=k;tiXʼG)K X)8j_%CHG[uz9Ͻ>Hd%ʲlt<ldқq)XYs Z6]TqҸv?rI[^v4k:&$;ux_E$zNeE\)㽠gwRjS]Va5чo튈m5 jdrd]@voøD8rP# 5KJRnC\N\lK"W|-:*… GY*x"{hnV\T_@g3ȅ $9dzJ bH؍l++bsrBGCÝ\ik%ƫ1#Ha*1t"NAg;܌,^? $ic)_-&= ҁFYƨzlHi`E+욽.y:mPz.XV 90V: 0t3vxiE԰iHwCv)VU?0'o?0>K'=eDQ#I_Yu`ߛcwUs"wCpO3!HrT 휪P 34P;V+76 q D5-'x vvw&9əwF/Dt91Vd`Ԧ(jsM); x={諑=4 H*Yx+Ͳ]Dʜ7J'pR8DxM(@#a^!nwǺ2\/*M!ټren\[(嗩w2Qx4{,r@Yx֤7gdmadֶrDB~fǕ@bȻ ьۇ~i"bt4(`RIBmIԒ-zkK( f`]EJn4cm3?eWvlXzQ,Hh AYQS(T9?1nX͊z:ĆEV&%ڴ:"Ǖ=C9sv!2vp.ΓMDJ` J^࿏ǨFJRR'p.xUۆl';\ pcr> +,[zCҔkp5&If}]0Hw#7{'!n@YJΒ @(5EL!݀丿V[-rY~֝~1pyi$igZb~:AckTOGU^ujKo"h'iJ c @2te F%|Z~W~{tSx}pnHzQ xa7͟B8,ƺGwudVzEʗTKὬݘ@#FF'[@Xf\tǼDu3< /sxz"4rUlXJ`+;VWJPtT|wMTZN( .^Gp0L*>5[l+.>sn3ƒ<͐L1DG9o0 p+nRោZFܫi0K)ʐcE8dėpuJdN{$گ8tdQ:&[a ?> +[qT=cȤc2GeWX-V]٩1$r6չGܾ1B|;+`LbS-ƎN$o ϑg#* 2Fuؾ Bw96K.b9Tڊ{%+JTt<2XW2vfwdQ7o='W?XZs4-ExGrvuZx$.:6cS&.1J ePuu/o: ae6|uz"Clpv3a|`x|V5RI-x[dV$a'fʗG: zX.kʼnx**:5ƸۊzghfZm@eѪ'W4^Cȣ:]{Wйy7a7 )wMcx YGY5G(j{_4jlaBɱL\%J(.9Ѿ-@v γﻫg(( i4`rfN(T/s9c^+Gl"sY C,S<4# 21Ԏ'5"ov:0wW7Sb}hR8J<ԛ\ q# jXB &d Kp/Smܕgg$w&$Пwv$˪%Q[p澗ۑ-G{{&h^`uڔQ@2C"hL|rIr?půz: d|8tӶ]ࢭW4a؉1:, [yj;8n^eJleuZ4rM#Dlawۯ ,wep>FHBN6VLΉܥ_$VJx@Lsai%{Mr"J,{Ϣ[Audm?y+xgrEڙ7 +R*4y:`/#eD2cFh q9\a!O29)L,R4حy Xtc%?[r]@ALkfo(e;sG/K1 q=mrO+a_9R5t{ >t7lMn(t񢄵˭_Ž_v[?V ݚ܉jfat 7sj%J !ԉK=P;|grW9+nJ7ؙlM|xg8@$B[*x!lLb:LdPkcP.E"~m\(V|l_ E3DPYѾ(r}C(@иҝmJc6@\Cւz*!<'9T>I n=Ȥ1ȩU\<8A;)0Z썦gͣC9꠿ !ӝ:`P%@QwB0SX:ӱ!gF1x6q PWHJΟs2)稛)xS2vи1Lv 7ͣX޽=f:cÑ|Ǥm@/EB$610]e!Bhrix4k]#ɋ/3Q/*oC}ӏ mpQz@eSa|b]V\ &pΛݖ0ץG@f."ˎ>d$l6N|oыxKF5-C/j3]i~̸Y fDB7zF1=ؑ(ɳ@⎓Bݴq'@;b; p .g^OH#z*tB &I7*d"nPyy %U4/8 ϓ.XمB_)?LUNI0+ - q PE6ԪL蒆]IסA%=ޑy.H<ucpg%HIAan)> ,Zc6J6 m06˄E{iȑ[?s-SG[lNjlmvWSw={hb–t!`~^b1@%Qe^D#,{5'ͼ;SN"qgLku(_Ꜳ۶α=Tp O=G~`*!LmT!tI_8O8@7Yey{9s=AN c}okn ֟S ܼԆt(1E+E p+Қnw*aI u.;DG7–@ZLteg !r?m2z0MLSmO*n94{$|6Q_ݑQeL|Ț49þ Z)ZjaF65Lr,C%'G@lsZ ~"㉊a?=.NO芻|! aܾ6 > y\XRjEfZ0@ǁM%,"4b|K_L&1\I\3/ ]D@(L UxL|+A;iIS1L98QQ:`YiWSxm/tѧX)x㐴x%fi۠ -H7лH5IsT{ <-rX8#w=>4" ;5eInERw ct͍w2Lp8}m[3˜JD/zlpe< lf!$rZ&[0Zh<#mޤ:H0rGȊi*3TgBM?﹕;G. 2-7^g pdUM'-[# 7ݝ{_^:;M#m&[BgY+g[x 6bGO\1}9۲ i} {tD-DB5 V4KDQ@g+ħ_~Jwam/p8䓷 AsPg{,z.c> \kIfi,}2З9X./NW:󺀗&1דF'&&._Vp! ё(9q\|>G/ `gLm"Ij &I!FG8Ӹ9WH0pA X- bktq~?&\\RJ]8'I֢/wewsѠB m^`G{:.(z9V簻܇Wy)BnTy'3-p%*͎ʬap,.A}Z.g-)p:ePPSɝm~ A\Dm>%/7aS)UP3% !eSط4ܪA,gJ#onbcXcꄊExErW1)\e7\n2_T0ʭV*)FK[o2~XjC )e?G%Aq3)ךhFD5K"0z7-0:ȱ]l('EbFp%vJ}$xU)U9Xx'/UG>8u#k#Cn\z)"ê:f{SKa3TgYV~d")^AHm }Etu B YWjTmDDmU&P&4*3(>)`+5QĢ9+T#]"A yf/s7zSzfN`=r/tavC஌?1Xv@*dSx+Zg­m&%0,5k4ۿ0o2 '9Zs1:kp\C’z=f Esy}fuQ`D1"mrNo淍r|< $gwQ[Hh=gX[`b≖q:+ -KfvM #bG'6Jﴷ8;@.pK.bE#ٔ ‹y~e>2e\(vM(OAG̋>n {(KrtfA2`~{>P2]!MG>Х2*۞ޢ{:^EO֦]-)Ñ&>{<.hLv}`.ß_Os{?jT>RZM A|}A6_&&RvѦ EjZ.M˲O-Ú9uiQ!OҢYkj>1*D9e! wr ŒshAh0b^DYevafO@?@H岤EeWS轝$ o޶O3YFλNN[1+K:(r#ؾt)&+O`` fTab?­0rW]=ݸWX\4.WP$H~F2V.S /ig9d#=1ɟDZiRѰs@5=Vblb fn';1`  M^ $<>4A<Жcqݼ㱨ha3o6\Ɲ9[hYQ?Ƙkl8 !b> [k Cί!cfh'P(D<GFSJ;BMVfGJAvɡ` 7{gnlV)\*!X,t0BbXF zzB]҃{>W<vw3sa\~CXc¿NW0R`\Z.YAxp旍%o6{6oOŘth:xJ-]Wʎ6Ľsk,h"@a^joeK;D\oJ y`A7SQ9BI[qVG_>;\xc _#LeKk N")R vYjw W4ƘYsOn_W/JXI/,(ƣF͎mw"Qj>rs] ڧH,Z}JB{|MEsϤtwH~/:Ը3\t;SS4ȃ׫y=oA{׊y8*9Fa ]L3ڭ(JdiMT'vъ.ĪGli0 C \!l:}REa;ϒ#FnYkV10Ҡya5oՇjAGDUcFhgk-ҙH9XͧS$L\Dz/nyM+/ &xa՟f}tR 3ŤoDy-sMxa&*=_z9mK[SuϠS}SƗEn(lnőv-*AգW”iDk_k& 8bGϦq~LsaMh G͆ ȔB|Z65-#=-Ez<^(-#MpvN#CQL{Jƪ4$|IK/_Kbvaa(>siawxvAVh*sG,Bp/ŵeS=^.[こRtB V^+E۸!ֱIPO9[Bڧ~7oq1x*_V}(IlG Jq_Uj1SFqsHY/8ٰ^@J0GPXJ):VCK+Ce3يJ:i5#};;ٵha(`vMcōމ; [\WG(Wŧ=4|g^73Z pU'K꼍(IK mYk-#wвհ҄.5xqZ+f[<fnĈ.p"^ޭ_ @(RrbMR= &}+rbn=~Cn`fk xBy_8Ae@GSa(h`FA ńu䚳e$m틞;@"A~Sb̦O52k$e#?IK |WgezwSY?4##񔚋 `V@o\Unc-mtΆ^N ؇C?ATSAL&Y3f=;S*clN L~R^I&K|]L'5QU5_iqzLD=T.aINdtc+!KZs(2ʠr}Vz"y ތb%-A F~4<_# h [~}[/#5$e">"c2ԯphy!Oc}Mhx3Y3,QG%ڶ29!EJfCOte9敟ٰ>&;IՕF}#syv˫w!\d0gP@n7 6GZ3 (=8"1|x!eQnf^P/.ECtMg@E[ 7IQe]` |'6$a.[է8i).V0vG>F5][#4Z0ՁfCN髉 og\~)Hi -?fЫ|YbEbrM6㯒Y\Yf.WDƫ#xKt qRwr'y,)sc[ԎWt.Zny7# ՇVXQ`IFt`EgM!M`Iߟ$*H"[]C"ŒwxZ1"To"-65{/Q*3XeKz $u|۱QHQq:fGG=\Y/PI;?BS^}am EL`4Y6 9I}95;Cy|gegÙrI . !wjG4Q޿v@%$;z9ƃ0T%]ƶQ.e\+F[>2 2s\xqin de"% je:?$K GDCRr(Q{?F?5(dZ,/I/˼:T&J^aEhodD}; dM\'S~ m!SYrPulF@Vu!gݽ9=xl,.,=re.ߜK)9սkF{-taZ`2{4oD^ٻ6Nw͢HDmVO2@>g$DPjg&EVU.]a XeX34ۓd<Gٿǂ9Kw4;Þݺ|C/ĕr_kj|f]P%PyeQ`< bOi#]y}Zj@Ei9^P^s&AfyP`jќO)"^v= w%lK~:bPO'6\ׇSArl)Z2UcKjC,rT^]>DHkYu r5s^^/X͑$Q]IFq<@cR^v^)Qmok@ˎ]ݠO~<1I/]ͅ3:UXg Sѱ2|qJ;6IЛLUp .G9 I/ ZVʪk]|ىM0hhȇ̀\2)M3Fmy- A .LAd_/kىϚ. r [^>`.K Ko]>:jJg&2&N g>{RMֹ[  A+5yb)kr" # b?;-+mx}Yb6$/@FwH 7 $Ջh~B&Mu TȔ?^Ai&*4ïėH_ou2#*GYG5^-4#nOV" B4-@w*-*@FC>wY#j+`s{{%wZ{61$ÕϷwf ,Qw>zR3b%[[ JS&H"dN+-`]ma)emJk P*!ssPo1o8E]][.˞5)cJ7Teuٝ߃օzwtIҼFgFwtՕV›2+p2 p"w̗+~ mom:}9JsVS@PD!Fhvm3ĒԬi:/x\_mbLdfq6$ઙf3G#X?O]jb8i[rY;*Ƌ5.2JӉ$]eG٬k[:Zq^,Cʟo4,Bv7 qWWǽ a?jSbg/2A1A &$8(Ǩ&,NU~[˔ 뺹 q_t2J)I<ɯOJ9/KR ^ti9}1e2%6 tP#; vةwjŦ12ˡ EWnN*~Q( enwF`r:ФXk%8y  : ;7i[TNEfl>}ak}5C!{k3{^X~'lfaa9w3#QZ걊`+Y㿕WKN*"/abdCP#ܱQc "xe,SnJw-6й"nBҶq_W7ןZ d+q x¹aƟX]d7%Q Br~ZfQ%p$GH- kz=l0F Ð뷳~>r@Q.{PnP$t0=-s aX{U_8 ĺ~ nZ`öXBXLDLdjKb{p6rEk~ 9*+Ƈ @h@B4; bg;PJQJ.R9r}<-͖[rݲpZco IG_cQ :g/_ZHhOzjy>SO'e?='er1 beF!2<뾹Xk;-h>"_u@ uWP-&<.{qӀ9r/w؆t}U7]&`$9$1C؏I˂BqRK S"k77I h3T [ z -Tjq}N=?Dgfx( 'M1񁵒֋MȰFh͸N=Sgc$h_NqJ#7 .}Z\1%wF%`CI ]4=t\p!L_bj?kf迣}soGlw2?Z_@짰Pa6ז _1Fn 9] TXF@y%8sXM遝ZTA0z]y'0 dr<!<`ֹj296"WC||+'F̋-?K8J`k{x4+޵H|c>/-#-PA5ZPs_%ene0d [o:q\:  PN4vִ~ Hln5e7#Ds8SRVQ)ـVј[lX&Ȟ]H5c;gGPD4 K2#ͫbʧ";@j4pf_$ vY*8|:gJun1\] "67M󿑨֜\݀vqTNEl3-Ye7e;W31 _4Nc<թ Y/ml5Zv x9..sYwZ=C`ܟ]]Mଐn|N`㭔 gSĀq srW<=K чj'2# Q*#Cv}ޞv*Tx4Ag(68;TaU;רfD?-بI. DC.غOe6c\G{K AKdS5ǰvwIVGwح͓::pA`6@~ yW6Y7ރȭlp&K)~ [#{j^r_ީ=kz޴(jى_hxM>P(fT )ᖮ''xطVOH_طdٟ4"F9>_{=}~np8jw .I !5pLdoV/Cݪ(6ky1(#W/A}7(r=gRYH2{43Ö驹r >R&nQ-PEðIaXtOUtM{ioC>YTtciV2H ]{*ƸisPy2u 3ٿ WBʠC$~k!ug8FBI5UUQnaI^v&+͒UuMr7-Hƻty@AJc.n9̮/S?Izp&^قFfD&i9M4Hj%}aYp ztVf;hdQ- +ΣPpH]6̫ O[ ^NwP僠G㛁Z:%(6j)|gAhVunOvX󻀼؏zkEF8 dC{L8w6k8|{QY׸YT 9o~,]wUS/'bw{;AG=aˊܞ8$2hWI6>՜;!T=V2GU@Wgpqlt2R-f5UcVE.p<9+A[;r8nbՏp LRJ1_쪤JA0EeEqL9Qc (&k!7$Uxi׏^Ȕ]]f0hrm:~R l\j_Ľzv--MYীql>tÖ˲֢ўJk?+Q\jS MK>o-)T>K5.ϳߌo>kpcBH8&>H JG]t^,^~'l/F7*I.X5etX0+,Yu.^v\d%2K~]!^Eˈ@Av7+-ϋB{aJM^ńI0C6iuJ!xpQjz{^꬜}s4;dcI#pKp.:QY௬M#tKR8aIZ#'z]Z(+#\&)!h89%}ϙO4(pdz/4V7J~V;S_ȃd<0Ԣ@F滾Q&L&06h mF&oY\vNp o>k#}&W,{6pF3w2m:oW$/͠+a!kEEgݢ1iAoMv`t ^M`"9_Ѓ3s0|v4xM\odf +qnMa Eoq*0;+]Bt10^E`6D dkhNuNPH urÌwH;Fn} ˙w6WGB6+,bWRjGGh7#jZyM8P؝y{|rFBfqK4m0TJG52L]%4OcJJƳzJ軙j.x 4,]D 6פ^XZϋdڶy%uHbIi1+ `vHV:! 'PEƟu:V;.4K`<%W]RN [@ lV9@0r9J1?8і} r1p+ (' Ҋ{:QIrk\+PtF+oxP#_' u:;( |hI1KS9BMB$ 갶BbJtؕ7#i\eRK B. :K|m. +E0(Pc2`}=3e&|tA,T0ފò}q^+kaA$Zp寮ued!͊6DuWlY_ӕiլKjfj/xZM~x1ig%MQYwMw킏 Ay<"s`q!zNlf79xYn]y)eK$k- 9X[w%SI(L'GN;ˑ&ϧYxpTD&.?`dh{홆=W Ɛ-n1߆֑eK f$,?KtUuRKQeZ6 O`%oT_hHݐX@..Kݲgk2vΪR,I?M9ϿY]ۍCd%@Sc?ATR}4g֔|* #:oOsG\90BwBvc`s2pҚ)h̀H@E䷏wA<|` 0' Cdъ|(s 6ؔ0U-0I[rՁa)Q(lHZM*D(ٟiEww+⳱XEòy4LMWsy ] (1a[u;1`SG5k#[EP}{ fDk"@s͏o Uڍ VezBZYw]Ry>aY0QrdQ(Vre7;Heo"mhs$܆]1">''T@KR-JTPUdVyot8}p"ѿz6kȶ B{i ?kUصbN V/Li('jk tt?OG#6a6}Nد"A%dzg)S`OYITCdTEX*k#>`oJXe"ӴXт"=ϡ7F ޮ#- g/YwI8).4.C#G7 % ee, '$>m#}#$ ^:H}iOv'i ;B-!e|n,-jc8zY[}53Jƒ |b$uWN5ʃ'3Dp 9rJ3T=i{cY\$MLClN:x݌E7;vz&`tWg'J2֓gƫAKe~77ld"x %=P4Cz!\K)<Ⱦ'q28#g1FK%$6u#(%.zWM&TўHGǡѱ58d}DșПVjݾc<M1 UaP;MV!D7j9E)U#_d>41:5lxoy~,Rr7]%jPvX*pO.'R#~Ee.#]-~WC*)8?8oX?\7wǼX $W?#D}׷kL\MT~4O %)2hq7\o5ys N#uxR/,o;L+OVBM.+d Y7LO_-|9yNcB9Ew<42jWnQ >+J˷fn6+39EKL/ngu`p/[҄F wE7ߠ;3?M/dӢyRbXJφNVy7//{_5ү_x?XFT3kR)dYO#;׹t{{\<~u` lXƃcU[ ItEأWшI> 9+?ڭ!y5ap`YWStѭZ'D׵Z?; 3pn pw89-V|e#&nf댋V+@|9 %nqag?_ `}O f1j="|M5=fb3rjт 67% 9 ԙ6zxؓ Q\Դ1 H➻A ]biCc[;/ēTG䳝1{{d MVIMTo*KD@m3ƬnzVgӶ#~EM`%[YE GD9xS ),u%²qBiFzW )wW'zLD`nr%j F\/]eR: R}6\]St'd947wUo=9E- n2X*H5Y\Qڜ'pi" GMUq)>ۜa<$Gs&Ur4bmܯPOۑ{eb+N*CSUh'? \G+FL:7֙'gA<0:Vc{ƆYOqrͺw=)1 hA%:*}4jnFjh?ӯ[ײG2H,'Q)^ascDɬG)'C\Ɖ[(m3먕HzcTN\ C4݇zKA~QjѠ:Թs‘ 4b0񎱋]Ok:[ kƎ?wyQ:d)N=!g؂%zʐ~o0FOc(IOq ?WOj{:wX;U7[uXZ]أF3חG&s̾;ISTo8}U#x4o;(q-EәwY \+.5֧Z }a/zRZL2;t?&.'܅.o/CxdQL[)r`7`&A'c)=x"&=~4d?/n[PKN+{Y8fDѷHş_n v Vҵwi1}D ʹ\ ;J1csJ<_$]"8d}65+: s ^>LYj#X\fAv|vh9s3BB:_M~4k1riD6FՉtu(IM3eV3͜s,xi^p.}.{#{d+.G^_xΫ;8!pdAn8 -:)}*hC?x"ŒP[G8!r7Ky񷰐aC3Y)?iS+7m$vB{T*tF 6қ䄀<ݏde~Vwa{N-xqPmܥT'_Ѵ>{ Mg9@z"v2Tt$ J<yӸld=7߮ ͱA0ր`nIޕ$;F`]י$b4ц2s| X4.܏)ca4u-ú NN!sSqĕ4t0߱H/]'͹*Op5uRn*5u}=.ts斞WTTR~`EV .d9PÁttTn&~:(W~"i#}R,W(q6Evg/-UC 辭!#u|%omY'l04 k\1J$rs0-`-WKtl* mnu3RXc5RJy ,E k&WSM䬾{m._#cPVktNI#6oBAx-`[/4Esdv=(B+JÄR Vfy@osJ,YȂ걞լﰁg]!"4Pw8՗vMٖT#0^|u"$DB!FK=Z\pU< MClT|onYɇm‰0ײJ3Uoh?0R&ߵf .JV#Opאe'qjbwn3g%!"3wQNHx:VF&ڟ__Vvw^e.D8LCm댚|EkkXuxFDZ^E [֩!3ANʍ5&DxLDJڎ׵U}BaB?R|q ؋VJ/_ifDR7\ }aZ@ ڱ:Nbfc#a>xH&6i$qTPbUNCFO (6`_O%4qjʲ28ta>=;Qc.H饣f6<<-21vKϮf^p- *r;v`aQKwMHƱi Ng >4!0;V :`Y} xL*:fzipvͱ 6.pF#St-Ph ̀ݓcsqT&0nJ.4.ZtT6K>ӂf47:smu>a /^/h;_Nx|7{n֩mr9"GGcZPj6GG8I킖 ͮcGkB\m:U5#i0KHm:AЧxRH/sj=hXiRŕT/ZFsS18(bo~D"Z$:JϷP"/w^j6O& ˑ2 ? vd#_ ^7xf<0/ []KBfqaBd׌/(57 `;>_Ľ"X>nwk^ D1HD`*)%r5{Tj{9/i`qF^,kɡGI;M7{4'!uhɉsu|>x(/͘??җRegd[k(--Ei gd֘2cF+[[aQCW83W>%]8|Ƽ [RR6cTq֯tzq7Sֻ`@?5XK>:׀vq]q((@ht|qLAW" 2E [hA;A,0hOۘkHؒTKBQUkZFKbíp,[ _s'Vaߔ\l&}BKPsj#e^MJt53~߼&~7'a`$y h@f&5Jj(}_Xn!rAYG%`FkX4F2*?BELŜ,:Y c .)f:LskZyZ5صvQ?$&+4!Oㆢn4/n4e7(m]F^鈑eU_#*z e6qcH`BO3ܓZa~%Q/XUR:Ӫ} ytM[Oo ~UvfXUxYQňa1yՃ\B%"ꒁ}/3jÇ*>t,ꉦRnk=@ ~[wB;*Amv\yLwJF{d$:}+'vL8̖M7 9zCr l3,?kRiX66ǐ4ޢDI|I{W}So1A'V'K.IKV6(#v3OG3]C-b]~sSy+ MNP5ujrd.2U-S:x GZ>Dͨ UlqC,gYo"Ō hu 18foir6|mb~C9nTiʻ@aF:KTKO k={u@r0>Ut)I{В1l?QK$`ԤvT)2rQ2J*j'MW`'C0> ]3K6wQ{cnkI+H`T-oby=? >zee@Uk7j0ucqwFQѵ`YzEmK#(M ʴ;֥LYhYe ζB4@&<jP.T;K~eAI= .c^}I (@싞TܥQj%3ƃ+E[%c2(J}ۙݼ)ɀA`Cuƿ9-uA&AҰ-6*ђ >.A~Ogb8&Sy!솃[d.i9ا75` EE_h6,'tSNtkt~.3Aњ/^0ԉIVċP6ą[ kqaoF"},J%w:n/@|4U=<\,K ,zfufGa@f0?yj.pX_lx*ľ!]pbJbeNah\ JWc͇^`3XG.H8`Ukp*3s[Eg1B1TJugǸQ? ZhGKM11j`tkUnwx䎗Nk!V!UD-g 9 4'vaK~_uV#R8Oej|2\nzWOJ۞*r:+Micڴ;RH /~2PLR]qw4IQnYB* !}TLdoI8IB-)UYȷn76L3U qL.2e;MY ̓cO7dDMRHE8r3p 6f*C6*pMcZF^2yf$,mS_G -AÝOfwYe4?;S SB*}0rnxX.n;bv/@*]1`mAS;i1; ,P*#gf螹Ĭ!?"! D$Ȭ!%3B -s?xR[L)xZ2S/PwQ OyȨn}Q\?%+wvdc^Ĝvqn|g֪Own){iU-@Ík3(Q 5ꁡqv̬Wo0]IW\Q[u8߁)σ=Sh욊΍1dd!^F٨L0!y^Ŏөi-4r۩MK[4`}M'Ú 8ژeqA< !ЊKb^ıdк:źǠN1իat>[ a y޽)*i-y@᳝*=OXvT#w9_0}$f=*~(_`;*e%2 ~8+z`y4|5W6˫Q +heXt *ECVqF)IٻssSxa0{-e. Ov'YL'"6?8os#Nq:H?V97L 5o 3vo8PZw}aIѓaf 6Dmj )styUP`.e #nʷ;oˇƸ#"` H^?ṋ+"%2\M%tðd )c&ALo}=m?DI4צ ~zɧ90R?d24HVKT@c=Yx/?mF[hiSh-;5W_?*딁CyBV&AYg7EcqJ Bddό-S){QB9KP.M 3=IfSEP5?YvqLwGATaD&V@. *k3y&^Voϵb IX;QƖrt}Uiďo.&6دvD6P ewl~/"( & Gڕ&'RANsš׫!ɘZAVÖ'^՗!94mOWkL"AmnIpk~Vip6CI:C?3k &U* u}Jߤ{rzͮ3j-c~8V[n^x;+1(T L7I5Ɣ3^ aA^K} gJ*s7u۴OK ߚh _6d1z,>\1zUFQnЮ8ǚX.q#YNW&֪ql݃43 _I4ed1 a4 ~i0}׬s]ٙeN>ꢎWpЧ FHS/hwh(TojzhT0T/|DS+/& 3_秼w:|0bDa* ͱyKt!ښ58kA>#6ƐP&䄠fW`״rŶON6E1xU<.cD$ `Lj;t>G0A윫~l+ _p]v~!'鋅~|[,rqO_?8^^.O ݰr6$"C 6reY僌W:KF`M5 Ez#X*D8r$NgDx&Ä5- ۢ׭wHoF"vu- mۆ @3qJǦΫPTE9gD&z^[`TSt &Zw~uZmmp)G]@kQi pG f*j.]}!Ӻ嬿]TWbm;xeryYt 7FGͣm B`7u0 f܃M]a [-( bk|cB2ؤ~og>J&T߶\_iTLazCXPLwzaFV̆أ"mCWɧM3ݔƞυQJ q\2vhŃ]L2/(4lk 9%o,B-JSoAƼ:k،ݠnL ƑWjR,DPz0e#oflB,q0 GL ki׍Aw3NH^u1)lX&hԘhc$q }/d gf:cf~ҹKBq-C>BQT+wj%Fr' r3t:!X;W-byF߃M)W_7ql HA}xu7.HJ؂R/ Ne)2=f26Ft7g'-T5k}whcD% dOI^TB ' sXlC *\OʁwrC&Bʔ8koQTc_YFpȺG/1Q|X}\ku"'aYCClJߙTop|R}6E$_Cu1 Bމ»ʍEy곖U([N;NŽW򷷬5o7I,,}{/* AP<#cN.d_*Vi 2]Ħ-ۍ#\X,FZ|Z6Qfldt hh_ ЮntLC))c4 `}r]%WOL92tXEV ]{Q巵&kAY:9VP]" PAhJn2ֿTGN}ϙMUazx6;;Sx Ξ*k~sg Le<]A}P !e_lJMg!=eFUh ߚfetJ+nmy>Ċ(2ϊ~[RK ,qn[ M2ڛH ~آ=e^&EKg@XGȩ A̞z.xeJӶ@iHNpg)V{4Sg5^VOѓC,-^FY>zi hY}U }P~rB/lߜ\2 J=(@,?C1|*j7r#eC< M"{BM6d$uXƳdq}"]AY.}~7{g5|$NG 8,(2@?g-꽟x7Zۡ43gAوI&zX=ٲq*G,u/^ EcܶKcoH+-M7%,'C3neE=wv|x"zĪ:[9dO~f&:n[W_(^X_b7 ^-<39y)͍cGewl)G; +T:bE18kKDH(:?xjzJ{wT ?5"0W.dnP RN3];ViPZX-^$h)橷D1`!< 'b> 'Q(dkdíLc%u_ []b wdRc']&jg ؇ʨ/'ԉ BVxR6G-eIąCLD{vt+чHfK5qs]t1G'%*ladP 䒵ŘV~w2࣓꣊y[Y虥Ӕ]*>NIkt*é-Iwl}C$ Lw(ŪvY&䙾KsMux`qK 2X+deU*cTy:)b+#oz &z>Uc1zuEިH'ix09XouvQe (e9Vğѹӵ1#Y6b&]7L/i  3dzPH9՝' d=Hf`uR-B3e1.axGZtVGVhxydK^{A/͙֯4NE鰮J.«ʲŰhs+򺷟ɩ Q\?&RJ ܖ } Ma})>S!UOAq}@ڪ@l>鹪4 vFJ #.kIz:a\&IR@.I7O`DjDYȰCIA{e뉐 04ƜMčn8#ўt,Ƈ5[>I(»{RYzB2!%e9d-)Z!nA]ˏ'CʤGX$ٙ}]0Y TXiҴaiqlkW~QU ^,z\baΪiDIm#۞fB? GGO' άՏ|:A5%Ƈڛ3l—=@$ÀOl ŎG=B%v tᶒ׵X%@s A8U$b;NmiQI #-XtRr,i^mbgV}[er%dT= x̯Qwi3X^NT2k&L`{!Pױ-mC4#Ӑ/}QڜJX<0"Nwj1 L@B;<Q>lM+GG hS K'N"}1=aӢOo/@uppH<bLT"+͈=L,|^Zi jgW.ߒ`) yZDJr1ZCEvx&~}$yW[m{6?MEB.ە8l]2n%DsݾtQ~*BP:S mY+˽}UPɶ$<6C~AWGG8~V?҈ 'JNʶkhB@ .tNc| 7 ZP̷#M 0STV9b,K ͇2~ cH<յͿ7[*!I|Eb!& RQP)- \bՊe8 @1|9$O2ݎ肆LTE?.^hOYޣ{|\!>*ݲus`lPR, /ՏpPxvd1RHHMِ,ύ&WluMd|2*; jڑoIbn`zTLz[42 Z+-*uGg~(WvqՉ[3A0syݯF!d7)[,Tvrv,m V.4D0ݑWXITLk! } 񦶹PJ0^a1`&S,O$Y]?t\G/6>eaYX\T 6h/vrazq /g`pP Q.{7)/3R \#e~:tPodj@.*&Hg"b}=-"$fg mQãójl}Yl4t&P'DM!CTu{惋*Ruqb3=-H9Q-ochOM -,$¥j`JUi֭O=E#QNҏρ[k]e0B< 1(C;%Q_cx9f#HMH; c%K99`A ,g.QU[cp SUdݾLN|h=kq+W0M5 a|&g+WTn6䥋NpYqZj%dRN[wެEg?HG2@Aj?T))"')oaL s_9REaq8u@O2ƏM9G֛)Fbڏ7vPuUΟ:Ϡ'E[ǘ㻫fY<\ O{eX[zh5 $QEԔO9}@pY_o-441iIF]0hؤ(gXP18U?,"7]TbS#}H6}-s?Fl_$rY*Q;@fW(_)*%Ӧ6q U剹7=VlK]/f>w ߋe q ->C&Rx~e4k~Ry',@ X;̲ـs" Σ-*6nՑ[Qb/xLIgd?cKtl}# KfbA7?kDJOPԣ>ʈw d m#=ھ.)"0L aQ+0J:hcր@;ChCiS ÇńM+PiB@|pPaJR:iU޹o1M;Ulaq?@uljP~*X3S͌N1{\D\X7&8g!0 Yep};RF``pB9Aǿ)H4l,5TiL%_k%2,/AzûY@Kn(CN54P*.'Z \Zع pmStS-s)S1nod!7}}D݊%D!Hhso^YPSC}}6@kJ)0gsU 6҄NqkE52,dPf'H?KʍVچ[N6vDU"v:}fCٞe'E2CH|(VR9qvIl'E&#٨&kgGݔ~Zq?fBOַw*HdCz{>EIiRx%iHNH~[>g޼+3L-ۭq%46{94HxNVs-R˨l ӓ4/' 8dW./.,biӦZ,,)$7#̓%YJvю`C0,HSz贿 r2-wj[zHNUy]3-XӪ6Z~nʰO ]3>}.QtoaH&dƌ =j8Sn[;}Ql$wj'-{9i,) {Ғ 7!D(4<v&>/1 >Q֌tNL0Swj?|cW^Ύ}ӯ)QLoLg6n2۪mc^fmer>gnOV$f0d;i#u]%>/+?םwwm 2)\jm 6]JbUzWGC,3WdMĿ1c?g[1~W0oھ@9jqK%5GNF7Cz\D;€"nJa–}`ABC8XܝpVJbg!ˏ0r\a>r&X~]v NڰJ@R7 # ہr9ّH!j=Sc2 A  CGpYXQ4mt,K92!zuUnї2:ȔJx"| 齘 SN!^f0Ʀ'gh|H?ZtƂ&bvkokwIr*ࡷRV |E :5{ɺ?:Ckb MdԲ/]Kss0D¢1X(#3749mCJVsV̩|j}NP_ F{ui\1M,/ca´ 'Tw̿]^l әu(~޴ccP j}IFSh+{@n!QكU@6jzHbKREfa٤]\QņyW@]G \vq$M8AiLN2y]13&%ÿS;*~/A;wAԹji>gPVY7&Ş=\}%a=+>' ,3"]=`%#vnk|qL^[$MyUA^/GNc.Ehox^|iS iĦiu/_͎lphro/ծyoseWqrCKS5ۼ9)w)62E m#VL\0N ~)ieO!▆%:ۼ!/o3*5J1z@:¿@6 NS!绉fb<]}\J*E]V(9N +BCa V~z,)>@g:m?f^vM':ymF]UsmAozlYI;C?Rm\ՠ`+l^ܮFLx3f_Tf)Oz}oqBȃKg]ʰ݀WcgC)]EXۈsng̨O .~#IB@× eTpyLZO?yaRWm<:7}< o"˚If4(|+WńڔMT'3mHl$Oy N};ەM$?F~UFg+$3~g %(CU6 TijyGԗWږAcH8OunNCKR.0ՋJ.zn>t WnYo)hMqNoLtP>ET ~8։Z[r$ hwhXNO>ވMUkST&b&'a'퓸1mQk #BLW|Jw鞟QFH)`<}48(0Rh^n|uPNIm)Gw`wOKh= (ʊ QªBiPZA&TwMUJoʊ* K* 􏗖Of1Lk]TTf4 ,s0e}s3Az}!¾xx&z6Vg88 w #,;eGre~g4**tڶmvЋ1\Z!`S4K{Liy4FzCuG3)/w5 mbjųjZx9n]n_J #C%n[-i@[ ]$6FH02o< "h]x[ duB*ƨl^jWh3s [!ϱ g0L=Cߨ_Wѳ/襴f(nz,\ҔIPp1@ޣLog%GQ1rTAlJDr2D@)lGXhxNXz]TGǧ`*Qo,sNԧ-FOtCQFh nl,˹d$!'k惀\5pzT Gډ}=}jtl4k ޳jH66zu@u<ҸVu=>u91E? d+P)nmTWCk+-WKןĆĤ|Km!J'1 41Xs ˱m5P5dl;rG)g:&;z3N'*M*kUf.YMPlP Ы@@!fҚ'Lp %yH C |9 #-ʰ 6!IVCf UH8JW3Ȯ9pν{o'_uѹ1J a @bC/h =b +gT(Y,GJ}~lc wJ BFC"氰|rcb^GK2iqi0U:t z_Ϣkz9*X7( QʑRbZ<\g獅)  <=?xQ>~.Tw, "Ulwo_ Gjv뭏b ŗǟBfHk:0T>qȲm$]g{X+L t}yǿ&(O |2B[VԢLVL|yN+(M1=j_mRT CDgf4%ӯ[v'mv/0}E (cW?[^ky6&/'TLιXvJQSz}ޚtal͜;IQyӥ&askAuSqŝjcHAcחHr\60$ V@ΪkgkJc_1YA9-r3UA1,) [%d/b(u_xDc;??B34rA[I'"FLZ(٭4h.$)HEewh[ 䇫qr`)%?afI1=Ju_z\FK1}VpZNa5)OU%V(ۊD=q Wmoj?&IƇOtD-bLc34O&X0uw C]nҵ@Yi͛oGnU9F5G =Yt^)G^&StuxW8a$B;}ܲKg%pKsEѕGiKdx0ΨB8"Vs8)CLOr\$nWܥeP 62 X> (飐P!4Ƒwk̙{te('V$͵sD=}{8Fd( +^ݫQZo>cui+Ц6p&:tǫg|pC؊1^b9$J T,([^RW9Y#ڟipv#rdՀ_}+SڒH,8mLoܱ[B!OX;[x;b<x,6J9BѩBH7_r rۃ;ۨG&)@aZJgy;2?: xN/|*6וK%Sб4I2zZI4o =kldlxNɜ*kHВTen?zz$rS"D`6949X1j I"RW 5kq.bOH"„ժo&{R9űa *<8wu<s-- 4(fKn|ujW*51)q.= ji_F] 񈡌Ý񌷡u}FoPjSnOzhD殮LD4)uԦl ]Cc`{"m:W(r{9έ' 9'+xmjaMwdÛDy4?v[h=@Q"0Ũpw &b )Wvߠ8^̃t lVB=$>S|]w"K"ctwπK)\3_N |F@_$.G0TN(م=  /޺]d@nJuŴAkΕ؈iYBbh0*/_M=Xyh9a]{>2`oƢ/(uIIaj).owrWD7 )!<#I8`\ufi)R E pT| `9Fܳ>85nh܀ci#] kq;D]TCqV$~4i;4X[IA7o۞d}Qk<0\ӿ=1UG ]$/HF t(ނ7-=;̓9}#qŎCTp\nhջ0yp"zv|0˓ХZFTG݆rA U/cؓ(Ցl鏥})# )H7.oiϮ5 ICz̍ pHZ_Ӝ%S EBa8x,uTWE鰑:l~ GA/^X/ sGy Y"ԏۡ0Sz:ejM c!}#-xʗj$fm[k3-uW{{59lEM=H \dy5q_$@%gr^Z=)-7V/dvp^ B; - 7rW[/uIWMm=rK>Jl;yJqi{ 7:A陥R`d^^J$~ ]ۚ*uMCøpdLmL{ ]IGhKxKќa wfPP-wLWT~bјGRbi@[̔ipuLg-*eyV ꊌrwq]Abb q^i_o`hdTMVpaҾPwMlP.`ئHk—Ӭ^sp8ܸ|Rw1)k^)[?P4cr]8Q衫*$ cAE+_:-J%ƼCP DV(Bpҵ{P~il_d".qi!Rt.^ UJD9CocFSt*uݮCtqJVwT UHaOk7MBLŕ6-9x[JyruYb\m ku9āp_w'.|ct4"Ɇ% NıK)_dZiyaUgBN|V5MׯiNak('jNÒRQH ,7^mcO@(c>Hd9Dj#OAal+aR9WIk _ N0݁Z CeIh_+B]#* q5s/]TLAvL߼r9r 65BԄUS|VJ%'w|2b ymJo0TKD)Z#aWyأay;`4Φd{F"~%rS:-(9̭\}?A9%Kj' ]}n2X6餲ITYu'Dɱ=5JaoeVl*;Ȼ-~̓'5'SB5^Ջh*OnDnWdSqf iґ )Rg$sS*#0h_p:9E?t<<%p̌U8 8`E"GH=U*'R=NP׀^d PrEl4j!` 5XfŶ xp3fM-{#c *C@[qƳ9Pn[Pah/Xƫl'X~΅vJvY燎ZO(&jlV.E&g.Vw4rC{%t3~T._0Ol݅zm{!6VxW昺}(lpK6feݶUrKE&Rke~IN2RvY!<dBHߔI,y8:A ~D|~= RnԈsfX'{E ޏbybU yuofyTKBw a!y {&fw fA-+BjB5ۜ_69/s :{wA2F(frY /'fTG)v(Sx,JUJYRGqynA.6^K7SCh*:v X>VLy2Tq,${IE%NJd qmt:'K{-`-a\8ЃlL( mrlPLMƿ$eȗ׉h -;Sh"uY :,ϙf{MV>=Œ̍jb2)#lgMM8ǧXm)E\2w{&4RZv~p\q3rƣ7[a(n-;:MLijQѽ:ͮF-0~ΈAK: fiUN(e R ''OۉEٕ*Ĝt8_8q&&QaPTU8anM%T"^ os|П~BzWsHkq?Y,%m<0y{H"蠃xsxyvH\/DJ{ѐԷ ;&ğÿ6dyO#k}*2#[LߟTN Tΐ\ZvZ: xOt4]ۋ*Ei{~OZl]ɧX`s0S|Y<7<ŻWQu E>gUt8m^RhoS- d7{:._/YO!XՎ9YGe|mPhSf/ 0KcQtI 0`=X@n8&+gtrc7C!+ Bg^[{0;S3 ZMJt-e:+/\\\_ PK)Ts!I5E# 5&$O3e~y#6.71׀=CYdfs)>ZA bKQ5k̫ 44|l:S`2 q7,5qgyuxTgad5{/>t%NCYtTxHzOG:ftS?|e9q>4&{HV3yԥE &ACJe10$'Al}U&&Tܛ`z=@$ V3kNj ,t ӠP(z|o^-Pk#0w tx.:Wb "pBpxxV^!ڤ}:\]&Z4hxE`R|O;8z׹U<-QTt9{sYd7D:xwܱ-#L?/5j0w f.DX5̄29m91ns~V(xt =.1@bڇk+*뇨!wgQ_(AׇBitڂ> ʞP RtEn~ҵ kgɱwIpSpV9,tS  7qE/q~T4N3 gtjTVH:qo|> Ѣ\FWQb|t4J dc>f>ME~jϗ~Z׏+J |\m\"E!f>:ţWC1p" $WD)aGFSxځ'XńX+bY`+)GJHѵAi;Ec:`>*=G`i2Ax$1=RL6$k|Jri{?[THXn C[,Q;J-j_!gZ_ؘxlWK ܦE~Ac ѡPcyL&0-Usz:f+LhL*UX/@eZ`q~( \瓳iBC zr1S}yBbGb6z(kyӾR-1X,化p{e_!'sGpWKX!D?p4\=֊G!_o_DX=ZAJ$ե)$l/zM=jo .ϿؑIFl1VSЩec}*xWyTjPtkQ\h[I!|*|EJLvz- :$;=D\+e[Bɬ;Dj)secS E^TsF(^y%iYm& 7i#~P@׵='qY$C-t;’>ȅ+H XMR백d#8ˢr/۷zFhOkJW2MR J 3Z8Q=&t붸/"mcA@&̾I`?7y{HUp_:DrUaϫ#Iߋz#ʜc\ L^'=)BvpLa&)!bIJx-8#&ȪsזO5tfkJ^yN4U&Hn {Rau4ÛmM_M]n];1:RE>_yz ;|NGHn&tҕozYYugj0S >?CسVkh5:l=oԳFYɂmO$h ևCJuT>Š"Lfs^ɯ܇?E\,׆o5QELs: <[yA|[.̟ra5 >gݬs[ ò(=eQnd2>['# _>\Z\(4. rZ${C?n_SUӑrCڈYm<-;,7s 2,Kۇ+*5vUwuɬ#Qb\ rmT{9?*KȮ.㮯m8&4K%>cApޒI)cro7i.t-u?w7DsK0=|^9+-hs4[UDk$yiX1v}EYgKVVvaK&,Pi˦;EC S8]~l NO W(Gm1С*% d^Jh5;9qNF̱ QRIL$@_v4Ƶt 'u U 5bn*b*X,6ӕ"r Zdֆ.'{ҹGswv*aj 9CF P,=X@Jw՟ ihn<;:cJJ1T$u?:Rڸh{'A`2kN#*;>ڙuJ 3¢:#:C^6q]d ^JbODߙGʣR+* g OdZiJ&oNo?6u0^c{1Wz/h?y {"AtM Ο5DXN:XP=άXzסA}L6"# qj75 5ctTmnLp7d &x!I*+g&"{ hnԬy Ȃ&!^|nTe~Y{2x^C3[Qu14H@8NOQ]z?dHgtY99?$䂄ڍ[;J:߂_Byz*WiP Or`}\&WK7y},^xCC2e^iBNC|H>1lc7k(J5YFԋ@a߶#@7[ t/ʵw:rcPTp .U}7]{XȊ4DDUV-Uk!!$/-:43&~zgzr۹cff UvB|b.w*V Ԍ?H{bN*,~TGy[z uoo OxSA0떯S\f 4Dqg#,<I -PY- E@P@[> s+=ۉd}*:Qa.PZcyQu4bWzŨ3QidDM&ixɶQofL6i7LR|ZVcag8:|mAo!#"H)ljutwWCǟШ6PlI.s̆ -ڙ'?P|W' 1xWfhmY[ՌJS=P@Z9nE yDS_]%dv"#dkH?˩CcĂ }eDu7՘珴BI1 H;kqء( |تSt5y1g~ˉD.._vL[@53 x[nm\i1uTЛUjMd8e$\ըH-~co| dwȬI(n\{`uYe/bհ¤wNZj%ųqeȲ8fFV{N'򥪘X]?:Y}4",hI&O5t*k /4=NXk*! ?iʹe/oxN'dHJD򾫁_vq.Q8Ą3 kumSutU}wH,z j0˫8 \lц9+Qm"%dӪ 3&ٝ-O /u o-3K"zdM*H7Fl;eH^Gw&3 nP^nFHwyhlk3h&-ygV#R|m+1 _ FkM!5ňD25qԏɛr+3V~~]D*V-槒OWU _89]$ℜ7\t\~S].$Dbf2Ma8W^g|xdc6hCʎOU!xH"̭g1z!E3J:c TQ, 2 S_c*s5K ɮ_\ǟn9ƍtK\M1 FS#D 2!1G&}ڒF A IS'@s|w oIr:="dIm6l>zY.c0;-jH*J7T| {@bof; Y}n*jU\7OC{0絩?V\ ,a zTpwx2V{x<qf"9[dm\ / i?Ud/w(!_s?;50 G2U &IqݗV' ňYެ{;Q;ܻ\K%Kl} 5ҽV{Ɂ\?%ŧfՒdDŽNWYlebz aPŔmu*@V 1 r\u)̨۬^0 qmlү Y {HcC9cJ#]AL{?gT^4Z4 evr Vv9>R+J+M>WfGExj Ѷ3+*^O-6vͨfVъڒ~T(hD2r-Yy_&jIGZ9' ǤG =t#ʚRUa̽JseqGliݺ6&zJPet-0 FԾtEBjrؠIJd^W*OuR!vkqUٻ&m1t7›oߊ:;É]u܋[ U`0T y*C8!,;{ђ %|%f]tWr|g\O&h B&f:.1 aFD*gٞLg#zW 1Q^?z I<(2R]%J>I1;Ⱦ4M#]v^XL2@2&_x NsTlk;{1lUxYo9b~M/*A vE$,!KeF%X7b0xvߍ(#[rwb5?TbP)rߛŽ50LHUeQO~ ]`[Ltk/n7#{NyƖ#3U',AX7"ʴ#Lfrnl7ExKoTگ(8LּGyú^xTwwEk;0zq6D!Tәf'OF0X~dr;ӏ_F;mOU,o3q`p{%NC*17ݜr"6- pv4(4E1?&!ʧq[;"e ,覌EP zk~Q4%r8R9l! 2av@>AsA# H;WkX[:UyV^*i(&OQ[4znwQHcLV4#7BZ0ҐVIc=C̻Ds?Mԣ [,V0"3DJ,Q 7Sҟd8&ݹVnjKΉ,hyaꗸek"^ϼd=JGnjSNLaK2Wu{ޡ:% u;opr7~]JZN5ytz+4tddVH~^ w\`ձ淜CE/uܕM2yU|(Rb!.O2俶zL?[U3ϋKZ>1AV_r c 04Fq="Up+kH+'T|qV-x o#/iMhI 9ACl?S0GAa^+&<:*`? //m+ѿf )LI-jύYifbIUFSYqXAۑ5џY ='8NU.3Ώ|?VjP~D0I8XW2il xGCK!%`,5JtIe DeKB On>JÓ:X/ Iu|q|n{20T l>2&1=BD{hHΝl&ß^և^ZI#R}=)d,"DA\y&L3Ut_t ɻ,+o-3{/'O(,t~*2-! sfFw~LQДp7]@ARc2u4;GWm{m \s6쾩Vk2iN{U)nւ6%F#+aLRӤ`ǹYaʁcjl 9;I 3 H.Gwǿ,ʃ}suiv'еoL> oQp4t8h *%mUQ,Gn!3oC&_j7M_.g4B++ Bi|si׬R9bS{ki(1mP%T8y.}=v^ـvj/֗_ nnX k!+O|Jz ։o_ 'I$.e+t12ZW Qw H5}~ch k^blPƦ3%t*yȴ̉ RO9":X g'WǔWt&Rfm +ܰHݒxiWM>ze*~Æ!W_]X&V2{ B,N, 6pfLc%Aw0Y+Ae y++l ~7YX 8S3?7 =l[%J!KVbػX*[b2Lc(i!p5Dz9g__Zu ݀ߚyar:}GP_Y g(QeO(K֊@35yᦠSO> G7]bLd(p.RA6GFQuڙHJPy|40uu9 BToKRh:.e 6AWHR.lCնr Iw?OLڙN|۩NHҼHln|Ifg E OVʫ#_|YR3mhRA ,;NЙ%.v9=ʐ+DZLVQ%RFJkX"FܨWG# @ ˜>7+X6ETC]@`!j!(g/ >@0YEʟLU8N$rIZ=j_c6^"V<>g Qo-^ǒ2Sه*ز:yR wݹ$C f*͹ozW2E9fdܣOX*ex$>p[wr4W̻||^MX&SzIW|iJE{y{5FZ{kjۡx^_Ele>'ٖa"z0&2oY']7wey2@_ѢĐp.V͎[hna1`tȋ$'N9Q 강 ;LPKY-ӓgP62<25%@,h9Fq_/0m K*;"x~Lg]*i,'Pbrxbuĝs +Uv8MARA8 Dl|@fOֺ,8Q+/fe,եEH5 3 %&鸉!Sh]t-n| 9yLnBI#vM6tWKLīCDR2t<`J2'y]b3'S2PPcsΩŋh=YS^S$]ܸ#;8Ht5E^t#(xMrP$zt1fۙeQA_\ii{MTm.B e( 1E1usw{V{f#FHEʄNCZIim_pnI TOл|Vm?}Ȏ읹L *9@mQFf({oZ>VLZJkj6KJ2/]Y}%mR]'J}Bz?$o{D'/@٫ 8$X)yv^ėw.k<G1Gcep>E'Vrpog-jy#oKo聵ݡHwmǗ8Y+VUeW3?5pZi m %Ew #88ڤ$*ـjQrf5İLb=b'o7Aeθ|Rz[@H!*%[0ƛ%kE< I[}"7i=5q̲z2决DG崪Mqj0F@d4d1 Bo=cg7RyU_1eJ2ܜ'Q T#Raȡ(Qfzc[VS0 PdUQVzAy;Ċ> aGzZ@>P^[M mnT? kUT Oc9$*'փ _ <=yOsIZF }lX ȷTv{{I/1c?u$BHKhf?Vxd/PĉKG\'tҕryPbxLMBholE~fA,[틎* #Dab"9wrDاxY$]=2l ^Rb>"oMQWmv vx,@0áRpw%]bl keHr?QNpV(ȶL%[|B-j׹0}vp(k "mG@#Ğo_g]^ۤM*87ʒ )Ѽ 05 rbS{bGf3ũv@Ij68p^VoV?@.`?DVkܚPME[?J εl~ɠ`Uc;%&ʍp*Tg21unU&ה_@G؊5\dfqWȺ>tOB D %/qX.O!5{kcʪ( Ϸ};laBkY%2J.gؒ>agj<ͬN1tRY8uv l ±_Gu4!_KS"*"  R{wԪ!;a {^J)a̴m/;;/x(GJw-5~N7wt\q?oH`uŧ䱍j݃H.l3p$VreRӟ݅T)XDqg6/Cw7pV/Ĵv\=. iZDjkKy^Gl}zrRef5\?eN="ryf!#3b.D ِA D2ꝵu.)ђ#rdRevd?;JE2 F X l`HM@ޏ 2"MU:;KG_M4 %%&F|Sod/hL𯭔D5IAˤUq}N}IjՐ'r}_\,e:[pY;j~ssH%ED dXX]zG }{+ k(4pg%~γ,Pt!ԖC3<9{C;VQ=Kےrn[,k (0V >$VEzCL C$P; 8~.j<jP\Vy&$i!!}k.=䄎S²M#VxKo3 K.&ܤ#,GXflԈāNC}:w UZ[ pT [,&hYMND&5%5zUgYZ07070100000000000000000000000000000000000000010000000000000000000000000000000000000000000000000000000b00000000TRAILER!!!dD.)~ +$+dY ՍTy GRwc YZ